![Western Blot: hnRNP H2 Antibody [NBP1-89816] - Endogenous PLS3, hnRNP F (NBP1-57273), and hnRNP H2 (NBP1-89816) associated with SMN in mouse brain extracts, based on immunoprecipitation with antisera against endogenous SMN protein. Arrowheads indicate the band of interest in blots with multiple bands. Heavy and light chain bands are labeled when present. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32938453/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/hnRNP-H2-Antibody-Western-Blot-NBP1-89816-img0012.jpg "Western Blot: hnRNP H2 Antibody [NBP1-89816] - Endogenous PLS3, hnRNP F (NBP1-57273), and hnRNP H2 (NBP1-89816) associated with SMN in mouse brain extracts, based on immunoprecipitation with antisera against endogenous SMN protein. Arrowheads indicate the band of interest in blots with multiple bands. Heavy and light chain bands are labeled when present. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32938453/) licensed under a CC-BY license.")
| Reactivity | Hu, Mu, Rt, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FIYTREGRPSGEAFVELESEEEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFAS |
| Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HNRNPH2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Choline Kinase beta [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Choline Kinase beta [Unconjugated]")
| Publication using NBP1-89816 | Applications | Species |
|---|---|---|
| Walsh MB, Janzen E, Wingrove E et al. Genetic modifiers ameliorate endocytic and neuromuscular defects in a model of spinal muscular atrophy BMC biology 2020-09-16 [PMID: 32938453] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HNRNPH2 |
![Immunocytochemistry/Immunofluorescence: hnRNP H2 Antibody [NBP1-89816] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize/hnRNP-H2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89816-img0007.jpg "Immunocytochemistry/Immunofluorescence: hnRNP H2 Antibody [NBP1-89816] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.")
![Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89816] - Staining of human breast shows nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/hnRNP-H2-Antibody-Immunohistochemistry-Paraffin-NBP1-89816-img0010.jpg "Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89816] - Staining of human breast shows nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89816] - Staining of human kidney shows nuclear positivity.](http://images.novusbio.com/fullsize/hnRNP-H2-Antibody-Immunohistochemistry-Paraffin-NBP1-89816-img0008.jpg "Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89816] - Staining of human kidney shows nuclear positivity.")
![Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89816] - Staining of human testis shows nuclear positivity.](http://images.novusbio.com/fullsize/hnRNP-H2-Antibody-Immunohistochemistry-Paraffin-NBP1-89816-img0009.jpg "Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89816] - Staining of human testis shows nuclear positivity.")
![Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89816] - Staining of human cerebellum shows nuclear positivity in cells in granular layer.](http://images.novusbio.com/fullsize/hnRNP-H2-Antibody-Immunohistochemistry-Paraffin-NBP1-89816-img0011.jpg "Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89816] - Staining of human cerebellum shows nuclear positivity in cells in granular layer.")
![Immunocytochemistry/immunofluorescence: hnRNP H2 Antibody [NBP1-89816] - hnRNP H2 localizes with SMN and PLS3 in fibroblasts and motor neuron processes. Murine embryonic fibroblasts’ (MEFs) cell cultures were derived from Smn +/-; PLS3V5 tg/tg embryos and stained with V5 for PLS3 transgene; hnRNP H2 and F-actin with phalloidin. c) hnRNP H2 localized to the same region with tagged PLS3. d) hnRNP H2 localized to the same region with SMN. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32938453/), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/nbp1-89816_rabbit-polyclonal-hnrnp-h2-antibody-20920231742121.jpg "Immunocytochemistry/immunofluorescence: hnRNP H2 Antibody [NBP1-89816] - hnRNP H2 localizes with SMN and PLS3 in fibroblasts and motor neuron processes. Murine embryonic fibroblasts’ (MEFs) cell cultures were derived from Smn +/-; PLS3V5 tg/tg embryos and stained with V5 for PLS3 transgene; hnRNP H2 and F-actin with phalloidin. c) hnRNP H2 localized to the same region with tagged PLS3. d) hnRNP H2 localized to the same region with SMN. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32938453/), licensed under a CC-BY license.")
![Western Blot: hnRNP H2 Antibody [NBP1-89816] -Analysis in human cell line MCF-7.](http://images.novusbio.com/fullsize/antibody/nbp1-89816_rabbit-polyclonal-hnrnp-h2-antibody-western-blot-12320248254..jpg "Western Blot: hnRNP H2 Antibody [NBP1-89816] -Analysis in human cell line MCF-7.")
![Simple Western Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/16390.jpg)
![Western Blot Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/Cytokeratin_18_MAB7619_Western_Blot_12720.jpg)
![Immunocytochemistry Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/Cytokeratin_18_MAB7619_Immunocytochemistry_12734.jpg)
![Enzyme Activity alpha-Galactosidase A/GLA [Unconjugated]](https://images.novusbio.com/images2/6146-gh_recombinant-human-alpha-galactosidase-a-gla-protein-cf-enzyme-activity-322023131935.jpg)
![Enzyme Activity alpha-Galactosidase A/GLA [Unconjugated]](https://images.novusbio.com/images2/6146-gh_recombinant-human-alpha-galactosidase-a-gla-protein-cf-enzyme-activity-32202314939.jpg)
![SDS-PAGE alpha-Galactosidase A/GLA [Unconjugated]](https://images.novusbio.com/images2/6146-gh_recombinant-human-alpha-galactosidase-a-gla-protein-cf-sds-page-322023141819.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![Immunohistochemistry BTK [p Tyr223] Antibody - BSA Free](https://images.novusbio.com/images/BTK-[p-Tyr223]-Antibody-Immunohistochemistry-NBP1-78295-img0002.jpg)
![Western Blot BTK [p Tyr223] Antibody - BSA Free](https://images.novusbio.com/images/BTK-[p-Tyr223]-Antibody-Western-Blot-NBP1-78295-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")