Glutamate Receptor 3 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASSEN |
Predicted Species |
Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GRIA3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Glutamate Receptor 3 Antibody
Background
The GRIA3 gene encodes for glutamate receptor 3 with an isoform flop and flip of 894 amino acids, 101 kDA each. Glutamate receptors function as a ligand-gated ion channel in the central nervous system and are the predominant excitatory neurotransmitter receptors in the brain. GRIA3 is involved in glutamic acid signaling, calcium channels, CREB pathways, pathogenesis of ALS, and glutamatergic synapses. It is known to interact with GRIA2, DLG4, NSF, SQSTM1, and SDCBP. GRIA3 has been researched with various diseases such as bipolar disorder, encephalitis, mood disorder, rett syndrome, lateral sclerosis, auditory neuropathy, epilepsy, smith-fineman-myers syndrome, and nonsyndromic deafness, and canavan disease.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Bv, Hu
Applications: ICC, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Publications for Glutamate Receptor 3 Antibody (NBP3-17081) (0)
There are no publications for Glutamate Receptor 3 Antibody (NBP3-17081).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glutamate Receptor 3 Antibody (NBP3-17081) (0)
There are no reviews for Glutamate Receptor 3 Antibody (NBP3-17081).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Glutamate Receptor 3 Antibody (NBP3-17081) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glutamate Receptor 3 Products
Research Areas for Glutamate Receptor 3 Antibody (NBP3-17081)
Find related products by research area.
|
Blogs on Glutamate Receptor 3