Home » Ghrelin/Obestatin » Ghrelin/Obestatin Proteins » Ghrelin/Obestatin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Ghrelin/Obestatin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Ghrelin/Obestatin Protein (NBP1-89773PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Ghrelin/Obestatin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GHRL.

Source: E. coli

Amino Acid Sequence: RKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GHRL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89773.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ghrelin/Obestatin Recombinant Protein Antigen

  • appetite-regulating hormone
  • ghrelin
  • ghrelin/obestatin preprohormone
  • ghrelin/obestatin prepropeptide
  • Ghrelin/Obestatin
  • Growth hormone secretagogue
  • Growth hormone-releasing peptide
  • Motilin-related peptide
  • MTLRPgrowth hormone secretagogue receptor ligand
  • obestatin
  • Protein M46

Background

Ghrelin is a 28 residue pepetide expressed by stomach cells that is responsible for the hunger sensation. Expression is increased during times of fasting, and decreased after food consumption. Ghrelin is initially derived from a preprohormone called preproghrelin, which also generates a second peptide called obestatin. Obestatin is an endogenous ligand for the orphan G protein-coupled receptor GPR39 and is involved in satiety and decreased food intake. Ghrelin antibodies are useful tools for lipid and metabolism research as well as neuroscience studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ghrelin Antibody
(883622)
MAB8200
Immunohistochemistry Ghrelin Antibody (883622)
Immunohistochemistry Ghrelin Antibody (883622)
(9 Publications)
Species: Hu, Mu
Applications: IHC
Growth Hormone
Antibody [Unconjugate
AF1067
Western Blot Growth Hormone Antibody [Unconjugated]
ELISA Growth Hormone Antibody [Unconjugated]
Neutralization Growth Hormone Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
gamma-glutamyl
hydrolase Antibody
NBP1-90927
Western Blot gamma-glutamyl hydrolase Antibody
Immunohistochemistry-Paraffin gamma-glutamyl hydrolase Antibody
Immunohistochemistry-Paraffin gamma-glutamyl hydrolase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Ghrelin
Receptor/GHSR Antibod
NBP2-16655
Immunohistochemistry-Paraffin Ghrelin Receptor/GHSR Antibody
Western Blot Ghrelin Receptor/GHSR Antibody
Western Blot Ghrelin Receptor/GHSR Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GHRH Antibody -
Azide and BSA Free
NBP3-04850
Western Blot GHRH Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(217 Publications)
Species: Hu
Applications: BA
Growth Hormone
Antibody [Unconjugate
AF1067
Western Blot Growth Hormone Antibody [Unconjugated]
ELISA Growth Hormone Antibody [Unconjugated]
Neutralization Growth Hormone Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Somatostatin
Antibody (7G5) - BSA
NBP2-37447
Immunofluorescence Somatostatin Antibody (7G5) - BSA Free
Immunohistochemistry-Paraffin Somatostatin Antibody (7G5) - BSA Free
ELISA Somatostatin Antibody (7G5) - BSA Free
(1 Review)
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(150 Publications)
Species: Hu
Applications: ELISA
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry Neuropeptide Y Antibody
Immunocytochemistry/ Immunofluorescence Neuropeptide Y Antibody
(19 Publications)
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
IGFBP-3 [HRP]
DGB300
N/A IGFBP-3 [HRP]
N/A IGFBP-3 [HRP]
(46 Publications)
Species: Hu
Applications: ELISA
Motilin Antibody -
BSA Free
NBP2-93868
Immunohistochemistry-Paraffin Motilin Antibody - BSA Free
Immunohistochemistry-Paraffin Motilin Antibody - BSA Free
Immunohistochemistry-Paraffin Motilin Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
PBX1 Antibody (4A2)
H00005087-M01
Western Blot PBX1 Antibody (4A2)
Immunocytochemistry/ Immunofluorescence PBX1 Antibody (4A2)
Immunohistochemistry-Paraffin PBX1 Antibody (4A2)
(12 Publications)
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Peptide YY Antibody
NBP1-80865
Immunohistochemistry-Paraffin Peptide YY Antibody
Immunohistochemistry-Paraffin Peptide YY Antibody
Immunohistochemistry-Paraffin Peptide YY Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(18 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Ghrelin/Obestatin
Recombinant Protein A ...
NBP1-89773PEP
Ghrelin/Obestatin Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Ghrelin/Obestatin Protein (NBP1-89773PEP) (0)

There are no publications for Ghrelin/Obestatin Protein (NBP1-89773PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ghrelin/Obestatin Protein (NBP1-89773PEP) (0)

There are no reviews for Ghrelin/Obestatin Protein (NBP1-89773PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ghrelin/Obestatin Protein (NBP1-89773PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ghrelin/Obestatin Products

Research Areas for Ghrelin/Obestatin Protein (NBP1-89773PEP)

Find related products by research area.

Blogs on Ghrelin/Obestatin

There are no specific blogs for Ghrelin/Obestatin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ghrelin/Obestatin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GHRL