![Western Blot: GAB3 Antibody [NBP1-86111] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/GAB3-Antibody-Western-Blot-NBP1-86111-img0006.jpg "Western Blot: GAB3 Antibody [NBP1-86111] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CTLVPRRISLSGLDNMRTWKADVEGQSLRHRDKRLSLNLPCRFSPMYPTASASIEDSYVPMSPQAGASGLGPHCSPDDYIPMNSGSISSPLPELPANLEPPPVNRDLKPQRKSRPPPLDLRNLSIIREHASLTRTRTVPCSRTSF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GAB3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GAB3 |
![Immunohistochemistry-Paraffin: GAB3 Antibody [NBP1-86111] - Staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/GAB3-Antibody-Immunohistochemistry-Paraffin-NBP1-86111-img0009.jpg "Immunohistochemistry-Paraffin: GAB3 Antibody [NBP1-86111] - Staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.")
![Immunohistochemistry-Paraffin: GAB3 Antibody [NBP1-86111] - Staining of human lung shows moderate membranous positivity in macrophages.](http://images.novusbio.com/fullsize/GAB3-Antibody-Immunohistochemistry-Paraffin-NBP1-86111-img0007.jpg "Immunohistochemistry-Paraffin: GAB3 Antibody [NBP1-86111] - Staining of human lung shows moderate membranous positivity in macrophages.")
![Immunohistochemistry-Paraffin: GAB3 Antibody [NBP1-86111] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/GAB3-Antibody-Immunohistochemistry-Paraffin-NBP1-86111-img0008.jpg "Immunohistochemistry-Paraffin: GAB3 Antibody [NBP1-86111] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: GAB3 Antibody [NBP1-86111] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/GAB3-Antibody-Immunohistochemistry-Paraffin-NBP1-86111-img0010.jpg "Immunohistochemistry-Paraffin: GAB3 Antibody [NBP1-86111] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Neutralization M-CSFR/CD115 Antibody (61701) [Unconjugated]](https://images.novusbio.com/images2/M-CSF_R_MAB3291_Block_Neutralize_2359.jpg)
![Western Blot M-CSFR/CD115 Antibody (61701) [Unconjugated]](https://images.novusbio.com/images2/M-CSF_R_MAB3291_Western_Blot_7396.jpg)
![Immunohistochemistry M-CSFR/CD115 Antibody (61701) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3291_human-m-csf-r-cd115-mab-clone-61701-immunohistochemistry-10102023145649..jpg)
![Western Blot SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]](https://images.novusbio.com/images2/SHP-2_AF3790_Western_Blot_5344.jpg)
![Simple Western SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]](https://images.novusbio.com/images2/16330.jpg)
![Immunocytochemistry SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]](https://images.novusbio.com/images2/af3790_human-mouse-phospho-shp-2-y542-affinity-purified-pab-immunocytochemistry-243202212955.jpg)
![Bioactivity HGF [Unconjugated]](https://images.novusbio.com/images2/HGF_294HG_3253.jpg)
![Cell Culture HGF [Unconjugated]](https://images.novusbio.com/images/294-hg_recombinant-human-hgf-protein-cell-culture-252023111456.jpg)
![Western Blot GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Western_Blot_5355.jpg)
![Immunohistochemistry GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Immunohistochemistry_6809.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")