![Western Blot: FAM111B Antibody [NBP1-86645] - Analysis in human cell line U-2197.](http://images.novusbio.com/fullsize/FAM111B-Antibody-Western-Blot-NBP1-86645-img0008.jpg "Western Blot: FAM111B Antibody [NBP1-86645] - Analysis in human cell line U-2197.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SMKTEENKSFSAMEDDQRTRPEVSKDTVMKQTHADTPVDHCLSGIRKCSSTFKLKSEVNKHETALEMQNPNLNNKECCFTFTLNGNS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FAM111B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Western Blot Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Western_Blot_5819.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19720.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19954.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FAM111B |
![Immunocytochemistry/Immunofluorescence: FAM111B Antibody [NBP1-86645] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/FAM111B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86645-img0010.jpg "Immunocytochemistry/Immunofluorescence: FAM111B Antibody [NBP1-86645] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human tonsil shows weak to moderate nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/FAM111B-Antibody-Immunohistochemistry-Paraffin-NBP1-86645-img0014.jpg "Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human tonsil shows weak to moderate nuclear positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human rectum shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/FAM111B-Antibody-Immunohistochemistry-Paraffin-NBP1-86645-img0011.jpg "Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human rectum shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.](http://images.novusbio.com/fullsize/FAM111B-Antibody-Immunohistochemistry-Paraffin-NBP1-86645-img0012.jpg "Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human skin shows weak to moderate nuclear positivity in the epithelial cells.](http://images.novusbio.com/fullsize/FAM111B-Antibody-Immunohistochemistry-Paraffin-NBP1-86645-img0013.jpg "Immunohistochemistry-Paraffin: FAM111B Antibody [NBP1-86645] - Staining of human skin shows weak to moderate nuclear positivity in the epithelial cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")