ERK5/BMK1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMPSPWAPSGDCAMESPPPA |
Predicted Species |
Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MAPK7 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for ERK5/BMK1 Antibody
Background
The extracellular signal-regulated kinase 5 (ERK5), also known as MAPK7 or big mitogen-activated protein kinase 1 (BMK1), is a member of the MAP kinase subfamily (1). ERK5 differs considerably from other MAPKs; it contains an unusually long carboxyl-terminal tail which might contribute to the regulation of its activity and/or localization. In response to extracellular signals, ERK5 translocates to the nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors (2). ERK5 also differs from other MAPKs in possessing a potent transcriptional activation domain which mediates protein-protein interactions with the myocyte enhancer factor 2 (MEF2) transcription factors (3). ERK5 is specifically activated by MAPK kinase 5 (MAP2K5/MEK5) and plays an important role in mammary epithelial proliferation, endothelial cell survival and normal embryonic development (4-5).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for ERK5/BMK1 Antibody (NBP2-58369) (0)
There are no publications for ERK5/BMK1 Antibody (NBP2-58369).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ERK5/BMK1 Antibody (NBP2-58369) (0)
There are no reviews for ERK5/BMK1 Antibody (NBP2-58369).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ERK5/BMK1 Antibody (NBP2-58369) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ERK5/BMK1 Products
Research Areas for ERK5/BMK1 Antibody (NBP2-58369)
Find related products by research area.
|
Blogs on ERK5/BMK1