| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERCC1. Source: E. coli Amino Acid Sequence: LADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | ERCC1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34480. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Research Areas for ERCC1 Recombinant Protein Antigen (NBP2-34480PEP)Find related products by research area.
|
|
Beta Tubulin III and neurogenesis Beta tubulin III, also known as Tuj-1, is a class III member of the beta tubulin protein family. Beta tubulins are one of two structural components that form our microtubule network. While general tubulins play a role in a wide range of cellular pr... Read full blog post. |
|
53BP1 - a marker for DNA Double Strand Break 53BP1 (p53 binding protein 1) was originally thought to be an enhancer for p53 transcriptional, but later studies have demonstrated that it is actually a substrate for ataxia telangiectasia mutated (ATM). 53BP1 is a classic late DNA damage response... Read full blog post. |
|
53BP1 - DNA damage is no fun The 53BP1 (p53 binding protein 1) was initially believed to be a p53 transcriptional enhancing partner, but it has now been established as an ataxia telangiectasia mutated (ATM) substrate. As a late DNA damage response (DDR) marker, 53BP1 appears duri... Read full blog post. |
|
Using PCNA as an Antibody Marker PCNA antibodies are useful biomarkers in DNA repair studies. PCNA is one of several proteins essential for the completion of nucleotide excision repair, a multi-stage process involving 20 - 30 proteins, and an important factor in repairing damage and ... Read full blog post. |
|
NER Antibodies in Cancer Research We at Novus Biologicals have over 230 products in our antibody catalog devoted to nucleotide excision repair. NER is a multi-stage sequential process involving over 30 proteins, all of which have been widely studied. Being the primary method to repair... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ERCC1 |
![Immunohistochemistry-Paraffin: ERCC1 Antibody (8F1) [NB500-704] - Anti-ERCC1 immunohistochemistry on whole sections of a lung squamous cell carcinoma, using Mab 8F1 and D-10 with CC1-mono and H2-60 protocols. Note increased cytosolic background with H2-60. Arrow: Necrotic centre. Arrowhead: Stromal axis. 100 A- original magnification. Image collected and cropped by Citeab from the following publication (Automated ERCC1 immunochemistry on hybrid cytology/tissue microarray of malignant effusions: evaluation of antibodies 8F1 and D-10. J Clin Bioinforma (2011) licensed under a CC-BY license.](https://images.novusbio.com/images/ERCC1-Antibody-8F1-Immunohistochemistry-Paraffin-NB500-704-img0005.jpg "Immunohistochemistry-Paraffin: ERCC1 Antibody (8F1) [NB500-704] - Anti-ERCC1 immunohistochemistry on whole sections of a lung squamous cell carcinoma, using Mab 8F1 and D-10 with CC1-mono and H2-60 protocols. Note increased cytosolic background with H2-60. Arrow: Necrotic centre. Arrowhead: Stromal axis. 100 A- original magnification. Image collected and cropped by Citeab from the following publication (Automated ERCC1 immunochemistry on hybrid cytology/tissue microarray of malignant effusions: evaluation of antibodies 8F1 and D-10. J Clin Bioinforma (2011) licensed under a CC-BY license.")