EDAR Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTS |
Predicted Species |
Mouse (94%), Rat (95%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
EDAR |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for EDAR Antibody
Background
The EDAR gene encodes a 448 amino acid long, approximately 48 kDA tumor necrosis factor receptor superfamily member EDAR protein that monitors the activation of NF-kappa-B and JNK. It functions as a receptor for EDA isoform 1 but not for isoform 2. EDAR is critical for hair, teeth and other ectodermal derivatives development. EDAR participates in the TNF superfamily pathway, the integrated breast cancer pathway, and the cytokine-cytokine receptor interaction. It is known to interact with genes EDA, TRAF1, TRAF2, TRAF3, as well as EDARADD. Defects in EDAR cause ectodermal dysplasia 10A and 10B. EDAR is linked to hepatitis, immunodeficiency, osteosarcoma, hypotrichosis, tooth agenesis, breast cancer, Clouston syndrome, and ectodermal dysplasia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC
Species: Hu
Applications: IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Mu
Applications: ELISA
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, PA, WB
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Publications for EDAR Antibody (NBP1-84081) (0)
There are no publications for EDAR Antibody (NBP1-84081).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EDAR Antibody (NBP1-84081) (0)
There are no reviews for EDAR Antibody (NBP1-84081).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for EDAR Antibody (NBP1-84081) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EDAR Products
Research Areas for EDAR Antibody (NBP1-84081)
Find related products by research area.
|
Blogs on EDAR