![Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-88848] - Analysis in human skeletal muscle and liver tissues using NBP1-88848 antibody. Corresponding APOBEC2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/APOBEC2-Antibody-Immunohistochemistry-Paraffin-NBP1-88848-img0009.jpg "Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-88848] - Analysis in human skeletal muscle and liver tissues using NBP1-88848 antibody. Corresponding APOBEC2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK |
| Predicted Species | Mouse (95%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | APOBEC2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | APOBEC2 |
![Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-88848] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/APOBEC2-Antibody-Immunohistochemistry-Paraffin-NBP1-88848-img0005.jpg "Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-88848] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-88848] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/APOBEC2-Antibody-Immunohistochemistry-Paraffin-NBP1-88848-img0006.jpg "Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-88848] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-88848] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/APOBEC2-Antibody-Immunohistochemistry-Paraffin-NBP1-88848-img0007.jpg "Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-88848] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-88848] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/APOBEC2-Antibody-Immunohistochemistry-Paraffin-NBP1-88848-img0008.jpg "Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-88848] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.")
![Knockdown Validated COUP-TF II/NR2F2 Antibody (H7147) [Unconjugated]](https://images.novusbio.com/images/pp-h7147-00_human-coup-tf-ii-nr2f2-mab-clone-h7147-41202412505335.jpg)
![Knockdown Validated COUP-TF II/NR2F2 Antibody (H7147) [Unconjugated]](https://images.novusbio.com/images/pp-h7147-00_human-coup-tf-ii-nr2f2-mab-clone-h7147-41202412505337.jpg)
![COUP-TF I/NR2F1 Antibody (H8132) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "COUP-TF I/NR2F1 Antibody (H8132) [Unconjugated]")
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunocytochemistry__Immunofluorescence_17382.jpg)
![Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunohistochemistry_23316.jpg)
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot CRISP-1 Antibody (840017) [Unconjugated]](https://images.novusbio.com/images2/CRISP1_MAB4675_Western_Blot_16494.jpg)
![Immunohistochemistry CRISP-1 Antibody (840017) [Unconjugated]](https://images.novusbio.com/images2/CRISP1_MAB4675_Immunohistochemistry_16666.jpg)
![Neutralization CRISP-1 Antibody (840017) [Unconjugated]](https://images.novusbio.com/images2/CRISP1_MAB4675_Block_Neutralize_16780.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")