![Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining in human cerebral cortex and pancreas tissues.. Corresponding DNM1L RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DRP1-Antibody-Immunohistochemistry-Paraffin-NBP2-34205-img0013.jpg "Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining in human cerebral cortex and pancreas tissues.. Corresponding DNM1L RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE |
| Predicted Species | Mouse (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DNM1L |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for DRP1 Antibody (NBP2-34205)Find related products by research area.
|
|
Methamphetamine with HIV induces mitochondrial dysfunction and neuronal injury through oxidative stress By Jamshed Arslan, Pharm. D., PhD. December 1 is the World AIDS Day. Despite the combination antiretroviral therapy, 10-25% of Human Immunodeficiency Virus (HIV)-positive individuals report neurocognitive impairm... Read full blog post. |
|
Understanding Mitophagy Mechanisms: Canonical PINK1/Parkin, LC3-Dependent Piecemeal, and LC3-Independent Mitochondrial Derived Vesicles By Christina Towers, PhD What is Mitophagy?The selective degradation of mitochondria via double membrane autophagosome vesicles is called mitophagy. Damaged mitochondria can generate harmful amounts of reactive ox... Read full blog post. |
|
Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease By Jamshed Arslan Pharm.D. Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy... Read full blog post. |
|
Dynamin-related Protein 1 (DRP1) in Mitochondria and Apoptosis. Dynamin-related Protein 1 (DRP1) is known to function in mitochondrial and peroxisomal division and mediate membrane fission through oligomerization into ring-like structure and sever the mitochondrial membrane, through a GTP hydrolysis-dependent mech... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: DRP1 Antibody [NBP2-34205] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/DRP1-Antibody-Western-Blot-NBP2-34205-img0005.jpg "Western Blot: DRP1 Antibody [NBP2-34205] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunocytochemistry/Immunofluorescence: DRP1 Antibody [NBP2-34205] - Staining of human cell line U-251 MG shows localization to cytosol and vesicles.](http://images.novusbio.com/fullsize/DRP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34205-img0010.jpg "Immunocytochemistry/Immunofluorescence: DRP1 Antibody [NBP2-34205] - Staining of human cell line U-251 MG shows localization to cytosol and vesicles.")
![Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/DRP1-Antibody-Immunohistochemistry-Paraffin-NBP2-34205-img0011.jpg "Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.")
![Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/DRP1-Antibody-Immunohistochemistry-Paraffin-NBP2-34205-img0012.jpg "Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/DRP1-Antibody-Immunohistochemistry-Paraffin-NBP2-34205-img0014.jpg "Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.")
![Western Blot BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Western_Blot_5904.jpg)
![Immunocytochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Immunocytochemistry__Immunofluorescence_22091.jpg)
![Immunohistochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images/af816_human-bak-affinity-purified-polyclonal-ab-immunohistochemistry-26420239384.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")