![Western Blot: TTC11 Antibody [NBP1-85664] - Analysis in human cell lines MCF-7 and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/TTC11-Antibody-Western-Blot-NBP1-85664-img0012.jpg "Western Blot: TTC11 Antibody [NBP1-85664] - Analysis in human cell lines MCF-7 and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FIS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TTC11 Antibody (NBP1-85664)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FIS1 |
![Immunocytochemistry/Immunofluorescence: TTC11 Antibody [NBP1-85664] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TTC11-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85664-img0014.jpg "Immunocytochemistry/Immunofluorescence: TTC11 Antibody [NBP1-85664] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TTC11-Antibody-Immunohistochemistry-Paraffin-NBP1-85664-img0016.jpg "Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.")
![Western Blot: TTC11 Antibody [NBP1-85664] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/TTC11-Antibody-Western-Blot-NBP1-85664-img0009.jpg "Western Blot: TTC11 Antibody [NBP1-85664] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human small intestine shows strong cytoplasmic granular positivity in glandular cells.](http://images.novusbio.com/fullsize/TTC11-Antibody-Immunohistochemistry-Paraffin-NBP1-85664-img0013.jpg "Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human small intestine shows strong cytoplasmic granular positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human Fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TTC11-Antibody-Immunohistochemistry-Paraffin-NBP1-85664-img0015.jpg "Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human Fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/TTC11-Antibody-Immunohistochemistry-Paraffin-NBP1-85664-img0017.jpg "Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.")
![Western Blot BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Western_Blot_5904.jpg)
![Immunocytochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Immunocytochemistry__Immunofluorescence_22091.jpg)
![Immunohistochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images/af816_human-bak-affinity-purified-polyclonal-ab-immunohistochemistry-26420239384.jpg)
![Western Blot Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Western_Blot_5909.jpg)
![Immunocytochemistry Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Immunocytochemistry__Immunofluorescence_22092.jpg)
![Knockout Validated Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Knockout_Validated_22544.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")