Dopamine D3R/DRD3 Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 213-329 of human Dopamine D3R/DRD3 (NP_000787.2). VVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQ |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
DRD3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS with 50% glycerol, pH7.3. |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Dopamine D3R/DRD3 Antibody - BSA Free
Background
The DRD3 Dopamine Receptor is expressed in brain regions associated with cognitive, emotional, and endocrine functions. DRD3 mediates the effects of drugs used in the treatment of schizophrenia and Parkinson's disease. DRD3 also binds BP897, a potent inhibitor of drug-craving and cocaine-seeking behaviors. Mutations in DRD3 lead to sodium retention in the kidney, resulting in hypertension and increased locomotor activity in mice. Multiple isoforms of DRD3 are produced by alternative splicing.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
Species: Hu
Applications: ELISA
Species: Bv(-), Ca(-), Hu(-), Mu, Po(-), Rb(-), Rt, Sh(-)
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Publications for Dopamine D3R/DRD3 Antibody (NBP3-03577) (0)
There are no publications for Dopamine D3R/DRD3 Antibody (NBP3-03577).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Dopamine D3R/DRD3 Antibody (NBP3-03577) (0)
There are no reviews for Dopamine D3R/DRD3 Antibody (NBP3-03577).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Dopamine D3R/DRD3 Antibody (NBP3-03577) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Dopamine D3R/DRD3 Products
Research Areas for Dopamine D3R/DRD3 Antibody (NBP3-03577)
Find related products by research area.
|
Blogs on Dopamine D3R/DRD3