| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DDX5 Source: E. coli Amino Acid Sequence: TQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPM Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | DDX5 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17654. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking tide related information and a protocol, click here. |
| Theoretical MW | 26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Western Blot DDX17 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDX17_AF4530_Western_Blot_5487.jpg)
![Immunohistochemistry DDX17 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDX17_AF4530_Immunohistochemistry_19615.jpg)
![Immunocytochemistry DDX17 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDX17_AF4530_Immunocytochemistry__Immunofluorescence_20569.jpg)
![Western Blot PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/PKLR_AF8519_Western_Blot_16592.jpg)
![Simple Western PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/af8519_human-mouse-rat-pklr-affinity-purified-pab-simple-western-1342022154119.jpg)
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DDX5 |
![Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD40_AF632_Functional_Assay_15457.jpg)
![Western Blot CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD40_AF632_Western_Blot_20204.jpg)
![Simple Western CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/af632_human-cd40-tnfrsf5-affinity-purified-polyclonal-ab-simple-western-58202111562.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_815.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_816.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/TNF_RI_DRT100_ELISA_175.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Immunohistochemistry CD109 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD109_AF4385_Immunohistochemistry_6832.jpg)
![Flow Cytometry CD109 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD109_AF4385_Flow_Cytometry_8246.jpg)
![Western Blot CD109 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4385_human-cd109-affinity-purified-polyclonal-ab-western-blot-2562021132617.jpg)
![Immunoprecipitation: DDX5 Antibody [NB200-351] - Detection of human DDX5 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-DDX5 antibody NB200-351 (lot NB200-351-2) used for IP at 6 ug per reaction. DDX5 was also immunoprecipitated by a previous lot of this antibody (lot NB200-351-1) and another rabbit anti-DDX5 antibody. For blotting immunoprecipitated DDX5, NB200-351 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.](https://images.novusbio.com/images/DDX5-Antibody-Immunoprecipitation-NB200-351-img0007.jpg "Immunoprecipitation: DDX5 Antibody [NB200-351] - Detection of human DDX5 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-DDX5 antibody NB200-351 (lot NB200-351-2) used for IP at 6 ug per reaction. DDX5 was also immunoprecipitated by a previous lot of this antibody (lot NB200-351-1) and another rabbit anti-DDX5 antibody. For blotting immunoprecipitated DDX5, NB200-351 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.")