![Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85294] - Staining of human cerebral cortex, colon, kidney and testis using Anti-DDX1 antibody NBP1-85294 (A) shows similar protein distribution across tissues to independent antibody NBP1-85293 (B).](http://images.novusbio.com/fullsize/DDX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85294-img0009.jpg "Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85294] - Staining of human cerebral cortex, colon, kidney and testis using Anti-DDX1 antibody NBP1-85294 (A) shows similar protein distribution across tissues to independent antibody NBP1-85293 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAEQTLNNIKQFKKY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DDX1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot DDX17 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDX17_AF4530_Western_Blot_5487.jpg)
![Immunohistochemistry DDX17 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDX17_AF4530_Immunohistochemistry_19615.jpg)
![Immunocytochemistry DDX17 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDX17_AF4530_Immunocytochemistry__Immunofluorescence_20569.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for DDX1 Antibody (NBP1-85294)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DDX1 |
![Western Blot: DDX1 Antibody [NBP1-85294] - Analysis using Anti-DDX1 antibody NBP1-85294 (A) shows similar pattern to independent antibody NBP1-85293 (B).](http://images.novusbio.com/fullsize/DDX1-Antibody-Western-Blot-NBP1-85294-img0010.jpg "Western Blot: DDX1 Antibody [NBP1-85294] - Analysis using Anti-DDX1 antibody NBP1-85294 (A) shows similar pattern to independent antibody NBP1-85293 (B).")
![Immunocytochemistry/Immunofluorescence: DDX1 Antibody [NBP1-85294] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/DDX1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85294-img0008.jpg "Immunocytochemistry/Immunofluorescence: DDX1 Antibody [NBP1-85294] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85294] - Staining of human testis.](http://images.novusbio.com/fullsize/DDX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85294-img0013.jpg "Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85294] - Staining of human testis.")
![Western Blot: DDX1 Antibody [NBP1-85294] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate ( Rat bladder tumor cells).](http://images.novusbio.com/fullsize/DDX1-Antibody-Western-Blot-NBP1-85294-img0005.jpg "Western Blot: DDX1 Antibody [NBP1-85294] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate ( Rat bladder tumor cells).")
![Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85294] - Staining of human colon.](http://images.novusbio.com/fullsize/DDX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85294-img0011.jpg "Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85294] - Staining of human colon.")
![Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85294] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/DDX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85294-img0012.jpg "Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85294] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85294] - Staining of human kidney.](http://images.novusbio.com/fullsize/DDX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85294-img0014.jpg "Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85294] - Staining of human kidney.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")