Novus Biologicals products are now on bio-techne.com

Cytokeratin 5 Antibody - Azide and BSA Free

Images

 
Western Blot: Cytokeratin 5 Antibody [NBP2-92884] - Western blot analysis of extracts of various cell lines, using Cytokeratin 5 antibody (NBP2-92884) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG ...read more
Immunocytochemistry/ Immunofluorescence: Cytokeratin 5 Antibody [NBP2-92884] - Immunofluorescence analysis of L929 cells using Cytokeratin 5 Rabbit pAb (NBP2-92884) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Cytokeratin 5 Antibody [NBP2-92884] - Immunohistochemistry of paraffin-embedded Human esophageal cancer using Cytokeratin 5 Rabbit pAb (NBP2-92884) at dilution of 1:100 (40x lens). Perform ...read more
Immunoprecipitation: Cytokeratin 5 Antibody [NBP2-92884] - Immunoprecipitation analysis of 200ug extracts of A-431 cells using 3ug Cytokeratin 5 antibody (NBP2-92884). Western blot was performed from the ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price
Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Cytokeratin 5 Antibody - Azide and BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 5 (NP_000415.2). MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGYGSRSLYNLGGSKRISISTSGGSFRNRFGAGAGGGYGFGGG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:500 - 1:1000
Theoretical MW
62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for Cytokeratin 5 Antibody - Azide and BSA Free

  • 58 kDa cytokeratin
  • CK5
  • CK-5
  • cytokeratin-5
  • DDD
  • EBS2
  • epidermolysis bullosa simplex 2 Dowling-Meara/Kobner/Weber-Cockayne types
  • K5
  • keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockaynetypes)
  • keratin 5
  • keratin, type II cytoskeletal 5
  • Keratin-5
  • KRT5A
  • Type-II keratin Kb5

Background

Keratins are a family of structurally related proteins that form the intermediate filament cytoskeleton in epithelial cells. The 58-kD keratin CK-5 is highly similar to other type II keratins and less similar to type I keratins and other intermediate filament proteins. The 58-kD keratin is regulated by retinoids in several tissues and is one of four keratins abundantly expressed in epidermal keratinocytes, where it may be important in maintaining structural integrity of the integument (1). Keratin 5 (CK-5) mRNA and protein are shown to be expressed in normal mammary epithelial cells in culture and are absent from tumor-derived cell lines. This makes CK-5 an important marker in the tumorigenic process, distinguishing normal from tumor cells, and decreased CK-5 expression correlates with tumorigenic progression (2). Dowling-Degos disease (DDD) is an autosomal dominant genodermatosis characterized by progressive and disfiguring reticulate hyperpigmentation of the flexures. Loss of function of CK-5 suggests a crucial role for keratins in the organization of cell adhesion, melanosome uptake, organelle transport, and nuclear anchorage (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34270
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
NBP2-45677
Species: Hu, Pm
Applications: IHC, IHC-P, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF7355
Species: Hu
Applications: ICC, Simple Western, WB
1129-ER
Species: Hu
Applications: BA
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, mIF, Single-Cell Western, WB
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
NBP1-18885
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NBP2-16094
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, KO, WB
NBP2-47940
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
NBP2-61736
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, IHC, IHC-P, WB
NB100-687
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
8184-CK
Species: Hu
Applications: EnzAct
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-92884
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IP
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for Cytokeratin 5 Antibody (NBP2-92884) (0)

There are no publications for Cytokeratin 5 Antibody (NBP2-92884).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 5 Antibody (NBP2-92884) (0)

There are no reviews for Cytokeratin 5 Antibody (NBP2-92884). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cytokeratin 5 Antibody (NBP2-92884) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytokeratin 5 Products

Research Areas for Cytokeratin 5 Antibody (NBP2-92884)

Find related products by research area.

Blogs on Cytokeratin 5.

Spheroids vs. Organoids: Which 3D Cell Culture Model is Best for You?
By Jennifer Jones, M.S.Spheroids and organoids are two words that, like “butter” and “margarine”, are often referred to interchangeably but have distinct meanings. The progression and adopt...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytokeratin 5 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT5