![Western Blot: CRCP Antibody [NBP2-92783] - Analysis of extracts of various cell lines, using CRCP .Exposure time: 90s.](http://images.novusbio.com/fullsize/CRCP-Antibody-Western-Blot-NBP2-92783-img0001.jpg "Western Blot: CRCP Antibody [NBP2-92783] - Analysis of extracts of various cell lines, using CRCP .Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human CRCP (NP_001035737.1). MEVKDANSALLSNYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CRCP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
![Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/EN-RAGE_AF1052_Immunohistochemistry_6671.jpg)
![Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/ENRAGE_AF1052_Western_Blot_19098.jpg)
![Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/af1052_human-en-rage-affinity-purified-polyclonal-ab-simple-western-2672021152820.jpg)
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CRCP Antibody (NBP2-92783)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CRCP |
![Immunohistochemistry-Paraffin: CRCP Antibody [NBP2-92783] - Immunohistochemistry of paraffin-embedded rat brain using CRCP Rabbit pAb (NBP2-92783) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/CRCP-Antibody-Immunohistochemistry-Paraffin-NBP2-92783-img0004.jpg "Immunohistochemistry-Paraffin: CRCP Antibody [NBP2-92783] - Immunohistochemistry of paraffin-embedded rat brain using CRCP Rabbit pAb (NBP2-92783) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: CRCP Antibody [NBP2-92783] - Immunohistochemistry of paraffin-embedded human esophageal cancer using CRCP Rabbit pAb (NBP2-92783) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/CRCP-Antibody-Immunohistochemistry-Paraffin-NBP2-92783-img0002.jpg "Immunohistochemistry-Paraffin: CRCP Antibody [NBP2-92783] - Immunohistochemistry of paraffin-embedded human esophageal cancer using CRCP Rabbit pAb (NBP2-92783) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: CRCP Antibody [NBP2-92783] - Immunohistochemistry of paraffin-embedded mouse lung using CRCP Rabbit pAb (NBP2-92783) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/CRCP-Antibody-Immunohistochemistry-Paraffin-NBP2-92783-img0003.jpg "Immunohistochemistry-Paraffin: CRCP Antibody [NBP2-92783] - Immunohistochemistry of paraffin-embedded mouse lung using CRCP Rabbit pAb (NBP2-92783) at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry RAMP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RAMP1_AF6428_Immunohistochemistry_11302.jpg)
![Western Blot RAMP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RAMP1_AF6428_Western_Blot_9866.jpg)
![Immunohistochemistry RAMP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af6428_human-ramp1-affinity-purified-polyclonal-ab-immunohistochemistry-27102020154839.jpg)
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")