For the picture on your website, you run four cell lines. The lane 2 and 3 all have two bands. Which is the CRBN?

Name: CRBN Antibody
Brand: Novus Biologicals
SKU: NBP1-91810
Rating: 4 (1 reviews)

Question

Accepted Answer

Human CRBN has two known isoforms, both of which are approximately the same molecular weight, 50kDa. Given this information, it would be extremely difficult to distinguish the two in a WB. In our testing of the two cell lines, we did get multiple bands very close to each other, while in other lines or tissue lysates, we get one clean band. Unfortunately, we have not yet fully investigated the multiple banding pattern shown in the image. The antibody is polyclonal, so we typically tend to see some non-specific banding that can be cleaned up with further protocol optimization.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, Mu, RtSpecies Glossary
Applications	WB, Simple Western, ICC/IF, KD, KO, Single-Cell Western
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated

Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: EVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQERE
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	CRBN
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.2) and 40% Glycerol
Preservative	0.02% Sodium Azide
Purity	Immunogen affinity purified

Publications using NBP1-91810	Applications	Species
Soohyun Lee, Hwa-Ryeon Kim, Yaejin Woo, Jiyoung Kim, Han Wool Kim, Ji Youn Park, Beomseon Suh, Yuri Choi, Jungmin Ahn, Je Ho Ryu, Jae-Seok Roe, Jaewhan Song, Song Hee Lee UBX-390: A Novel Androgen Receptor Degrader for Therapeutic Intervention in Prostate Cancer. Advanced science (Weinheim, Baden-Wurttemberg, Germany) 2024-07-03 [PMID: 38958553]
Jiang B, Weinstock DM, Donovan KA et al. ITK degradation to block T cell receptor signaling and overcome therapeutic resistance in T cell lymphomas Cell chemical biology 2023-04-20 [PMID: 37015223] (WB, Mouse)	WB	Mouse
Mehta S, Buyanbat A, Kai Y et al. Temporal resolution of gene derepression and proteome changes upon PROTAC-mediated degradation of BCL11A protein in erythroid cells Cell chemical biology 2022-07-12 [PMID: 35839780] (WB, Human)	WB	Human
Shen C, Nayak A, Neitzel L et al. The Casein kinase 1alpha agonist pyrvinium attenuates Wnt-mediated CK1alpha degradation via interaction with the E3 ubiquitin ligase component Cereblon Journal of Biological Chemistry 2022-07-01 [PMID: 35780831] (WB, Human)	WB	Human
Yamamoto T, Nakayama J, Yamamoto Y et al. SORT1/LAMP2-mediated Extracellular Vesicle Secretion and Cell Adhesion Are Linked to Lenalidomide Resistance in Multiple Myeloma Blood advances 2022-01-03 [PMID: 34979567] (WB)	WB
Mori T, Verma R, Nakamoto-Matsubara R et al. Low NCOR2 levels in multiple myeloma patients drive multidrug resistance via MYC upregulation Blood cancer journal 2021-12-04 [PMID: 34864816] (WB, Human)	WB	Human
Wu X, Yang X, Xiong Y et al. Distinct CDK6 complexes determine tumor cell response to CDK4/6 inhibitors and degraders Nat Cancer 2021-09-27 [PMID: 34568836]
Shen C, Nayak A, Neitzel LR et al. The E3 ubiquitin ligase component, Cereblon, is an evolutionarily conserved regulator of Wnt signaling Nature communications 2021-09-06 [PMID: 34489457] (WB, Human)	WB	Human
Powell C, Du G, Bushman J Et Al. Selective degradation-inducing probes for studying cereblon (CRBN) biology RSC Medicinal Chemistry 2021-07-06 [PMID: 34458741]
Misiewicz-Krzeminska, I, de Ramon, C Et al. Quantitative expression of Ikaros, IRF4, and PSMD10 proteins predicts survival in VRD-treated patients with multiple myeloma. Blood Adv 2020-12-08 [PMID: 33284947] (Simple Western, Human)	Simple Western	Human
Powell CE, Du G, Che J et al. Selective Degradation of GSPT1 by Cereblon Modulators Identified via a Focused Combinatorial Library ACS Chem. Biol. 2020-09-28 [PMID: 32865967]
Martinez-Hoyer S, Deng Y, Parker J et al. Loss of lenalidomide-induced megakaryocytic differentiation leads to therapy resistance in del(5q) myelodysplastic syndrome Nat. Cell Biol. 2020-04-06 [PMID: 32251398]
de Wispelaere M, Du G, Donovan KA et al. Small molecule degraders of the hepatitis C virus protease reduce susceptibility to resistance mutations Nat Commun 2019-08-01 [PMID: 31371704] (WB, KO, Human)	WB, KO	Human
Girardini M, Maniaci C, Hughes SJ et al. Cereblon versus VHL: Hijacking E3 ligases against each other using PROTACs Bioorg. Med. Chem. 2019-02-22 [PMID: 30826187] (WB, Human)	WB	Human
Zoppi V, Hughes SJ, Maniaci C et al. Iterative design and optimization of initially inactive Proteolysis Targeting Chimeras (PROTACs) identify VZ185 as a potent, fast and selective von Hippel-Lindau (VHL)-based dual degrader probe of BRD9 and BRD7 J. Med. Chem. 2018-12-12 [PMID: 30540463] (WB, Human)	WB	Human
Sievers Q L, Petzold G et al. Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN. Science 2018-02-11 [PMID: 30385546] (WB, Human)	WB	Human
Donovan KA, An J, Nowak RP et al. Thalidomide promotes degradation of SALL4, a transcription factor implicated in Duane Radial Ray syndrome. Elife 2018-08-01 [PMID: 30067223] (WB, Human)	WB	Human
Olson CM, Jiang B, Erb MA et al. Pharmacological perturbation of CDK9 using selective CDK9 inhibition or degradation Nat. Chem. Biol. [PMID: 29251720] (WB, Human)	WB	Human
Huang HT, Dobrovolsky D, Paulk J et al. A Chemoproteomic Approach to Query the Degradable Kinome Using a Multi-kinase Degrader Cell Chem Biol. 2017-11-07 [PMID: 29129717] (WB)	WB
An J, Ponthier CM, Sack R et al. pSILAC mass spectrometry reveals ZFP91 as IMiD-dependent substrate of the CRL4(CRBN) ubiquitin ligase Nat Commun 2017-05-22 [PMID: 28530236] (Human)		Human
Gandhi AK, Mendy D, Waldman M et al. Measuring cereblon as a biomarker of response or resistance to lenalidomide and pomalidomide requires use of standardized reagents and understanding of gene complexity. Br J Haematol 2014-01-01 [PMID: 24206017] (WB)	WB
Show All 21 Publications. Collapse Publications.

CRBN Antibody

Species Glossary

Images

Product Details

Order Details

CRBN Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for CRBN Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for CRBN Antibody (NBP1-91810)(21)

Review for CRBN Antibody (NBP1-91810) (1) 41

Summary

Comments

Product General Protocols

Video Protocols

FAQs for CRBN Antibody (NBP1-91810). (Showing 1 - 1 of 1 FAQs).

Secondary Antibodies

Isotype Controls

Additional CRBN Products

Research Areas for CRBN Antibody (NBP1-91810)

Blogs on CRBN

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Recent Reviews

Bioinformatics

	Verified Customer 11/14/2019
Application:	In Cell Western
Species:	Human

Gene Symbol	CRBN
Entrez	51185(Human)
Uniprot	Q96SW2()