![Immunohistochemistry: Collagen IX alpha 2 Antibody [NBP2-30450] - Immunofluorescence assay of COL9 alpha2 (h) of the distal femurs of 3-day-old WT and Prx1Cre, Piezo1fl/fl mice. Scale bar = 100 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-019-14146-6) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Collagen-IX-alpha-2-Antibody-Immunohistochemistry-NBP2-30450-img0004.jpg "Immunohistochemistry: Collagen IX alpha 2 Antibody [NBP2-30450] - Immunofluorescence assay of COL9 alpha2 (h) of the distal femurs of 3-day-old WT and Prx1Cre, Piezo1fl/fl mice. Scale bar = 100 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-019-14146-6) licensed under a CC-BY license.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PGKPGRPGTIQGLEGSADFLCPTNCPPGMKGPPGLQGV |
| Predicted Species | Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COL9A2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Collagen IX alpha 2 Antibody [NBP2-30450] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Collagen-IX-alpha-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30450-img0002.jpg "Immunocytochemistry/Immunofluorescence: Collagen IX alpha 2 Antibody [NBP2-30450] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & vesicles. Antibody staining is shown in green.")
![Immunocytochemistry/ Immunofluorescence: Collagen IX alpha 2 Antibody [NBP2-30450] - Col2 alpha 1 & Col9 alpha 2 mediated the inhibition of bone resorption by PIEZO1. (g, h) Immunofluorescence assay of COL2 alpha 1 (g) & COL9 alpha 2 (h) of distal femurs of 3-day-old WT & Prx1Cre, Piezo1fl/fl mice. Scale bar = 100 μm. i, j QPCR analysis of Col2 alpha 1 (i) & Col9 alpha 2 (j) in BMSCs-derived osteoblasts from WT & Prx1Cre, Piezo1fl/fl mice endured w/ 0.5 Hz, 1% intensity compression for 4 h by FlexCell compression system. *P < 0.05; **P < 0.01. Ordinary one-way ANOVA. Data are mean ± SD, n = 4. k–l Osteoclastogenesis by OB-OC co-culture in vitro using BMSCs-derived osteoblasts from WT & Prx1Cre, Piezo1fl/fl mice infected w/ Ctrl, Col2 alpha 1 & Col9 alpha 2 lenti-virus, respectively. k TRAP staining of osteoclasts in co-culture system. Scale bar = 100 μm. l Co-culture supernatants measured for TRAP activity via colorimetric readout (A405). *P < 0.05; **P < 0.01. Ordinary one-way ANOVA. Data are mean ± SD, n = 3. Source data are provided in Source Data File. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31941964), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-30450_rabbit-polyclonal-collagen-ix-alpha-2-antibody-310202416121986.jpg "Immunocytochemistry/ Immunofluorescence: Collagen IX alpha 2 Antibody [NBP2-30450] - Col2 alpha 1 & Col9 alpha 2 mediated the inhibition of bone resorption by PIEZO1. (g, h) Immunofluorescence assay of COL2 alpha 1 (g) & COL9 alpha 2 (h) of distal femurs of 3-day-old WT & Prx1Cre, Piezo1fl/fl mice. Scale bar = 100 μm. i, j QPCR analysis of Col2 alpha 1 (i) & Col9 alpha 2 (j) in BMSCs-derived osteoblasts from WT & Prx1Cre, Piezo1fl/fl mice endured w/ 0.5 Hz, 1% intensity compression for 4 h by FlexCell compression system. *P < 0.05; **P < 0.01. Ordinary one-way ANOVA. Data are mean ± SD, n = 4. k–l Osteoclastogenesis by OB-OC co-culture in vitro using BMSCs-derived osteoblasts from WT & Prx1Cre, Piezo1fl/fl mice infected w/ Ctrl, Col2 alpha 1 & Col9 alpha 2 lenti-virus, respectively. k TRAP staining of osteoclasts in co-culture system. Scale bar = 100 μm. l Co-culture supernatants measured for TRAP activity via colorimetric readout (A405). *P < 0.05; **P < 0.01. Ordinary one-way ANOVA. Data are mean ± SD, n = 3. Source data are provided in Source Data File. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31941964), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![N/A COMP/Thrombospondin-5 [HRP]](https://images.novusbio.com/images2/COMP_DCMP0_ELISA_66.jpg)
![N/A COMP/Thrombospondin-5 [HRP]](https://images.novusbio.com/images2/DATA_COMP_DCMP0_ELISA_632.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot Hairless Antibody [Unconjugated]](https://images.novusbio.com/images2/Hairless_AF5708_Western_Blot_5811.jpg)
![Immunocytochemistry Hairless Antibody [Unconjugated]](https://images.novusbio.com/images2/Hairless_AF5708_Immunocytochemistry_6520.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")