![Western Blot: CHTOP Antibody [NBP1-88085] - Analysis in control (vector only transfected HEK293T lysate) and CHTOP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/CHTOP-Antibody-Western-Blot-NBP1-88085-img0009.jpg "Western Blot: CHTOP Antibody [NBP1-88085] - Analysis in control (vector only transfected HEK293T lysate) and CHTOP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND |
| Predicted Species | Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHTOP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. This CHTOP Antibody is validated for IHC-Fr from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2), 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-Fr | Mouse | 02/12/2021 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CHTOP |
![Immunocytochemistry/Immunofluorescence: CHTOP Antibody [NBP1-88085] - Staining of human cell line A-431 shows localization to nuclear speckles & cytoplasmic bodies. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CHTOP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88085-img0007.jpg "Immunocytochemistry/Immunofluorescence: CHTOP Antibody [NBP1-88085] - Staining of human cell line A-431 shows localization to nuclear speckles & cytoplasmic bodies. Antibody staining is shown in green.")
![Immunohistochemistry-Frozen: CHTOP Antibody [NBP1-88085] - The staining was done on an E11.5 mouse transverse section (fixed on 4% PFA overnight) and done using standard IF techniques. Antibody at 1:50. Blocking: 1 hour with 1% BSA before addition of the primary antibody. Secondary antibody: Alexa Fluor Donkey Anti Rabbit 488. HC-Fr image submitted by a verified customer review.](http://images.novusbio.com/fullsize/CHTOP-Antibody-Immunohistochemistry-Frozen-NBP1-88085-img0016.jpg "Immunohistochemistry-Frozen: CHTOP Antibody [NBP1-88085] - The staining was done on an E11.5 mouse transverse section (fixed on 4% PFA overnight) and done using standard IF techniques. Antibody at 1:50. Blocking: 1 hour with 1% BSA before addition of the primary antibody. Secondary antibody: Alexa Fluor Donkey Anti Rabbit 488. HC-Fr image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human cerrebellum shows strong nuclear positivity in cells in granular layer.](http://images.novusbio.com/fullsize/CHTOP-Antibody-Immunohistochemistry-Paraffin-NBP1-88085-img0010.jpg "Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human cerrebellum shows strong nuclear positivity in cells in granular layer.")
![Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/CHTOP-Antibody-Immunohistochemistry-Paraffin-NBP1-88085-img0013.jpg "Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.](http://images.novusbio.com/fullsize/CHTOP-Antibody-Immunohistochemistry-Paraffin-NBP1-88085-img0014.jpg "Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.")
![Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/CHTOP-Antibody-Immunohistochemistry-Paraffin-NBP1-88085-img0015.jpg "Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Bioactivity Noggin [Unconjugated]](https://images.novusbio.com/images2/Noggin_6057NG_2865.jpg)
![Bioactivity Noggin [Unconjugated]](https://images.novusbio.com/images2/Noggin_6057NG_923.jpg)
![Bioactivity Noggin [Unconjugated]](https://images.novusbio.com/images2/6057-ng_recombinant-human-noggin-protein-bioactivity-1022023121039.jpg)
![Western Blot S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Western_Blot_17324.jpg)
![Immunohistochemistry S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Immunohistochemistry_17440.jpg)
![Simple Western S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Simple_Western_18705.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
