![Immunocytochemistry/Immunofluorescence: CEP350 Antibody (CL3423) [NBP2-59028] - Staining of U251 cells using the anti-CEP350 monoclonal antibody, showing specific staining of the centrosome in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CEP350-Antibody-CL3423-Immunocytochemistry-Immunofluorescence-NBP2-59028-img0003.jpg "Immunocytochemistry/Immunofluorescence: CEP350 Antibody (CL3423) [NBP2-59028] - Staining of U251 cells using the anti-CEP350 monoclonal antibody, showing specific staining of the centrosome in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clone | CL3423 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQICEMAELTRTHISDAVVASGAPLAILYDHQRQHLPDFVKQLRTRTETDRKSPSVSLSQ |
| Epitope | LPDFVKQLRTRT |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CEP350 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CEP350 |
![Immunohistochemistry-Paraffin: CEP350 Antibody (CL3423) [NBP2-59028] - Staining of human placenta shows centrosome-like immunoreactivity in trophoblast cells.](http://images.novusbio.com/fullsize/CEP350-Antibody-CL3423-Immunohistochemistry-Paraffin-NBP2-59028-img0007.jpg "Immunohistochemistry-Paraffin: CEP350 Antibody (CL3423) [NBP2-59028] - Staining of human placenta shows centrosome-like immunoreactivity in trophoblast cells.")
![Immunocytochemistry/Immunofluorescence: CEP350 Antibody (CL3423) [NBP2-59028] - Staining of A431 cells using the anti-CEP350 monoclonal antibody, showing specific staining of the centrosome in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CEP350-Antibody-CL3423-Immunocytochemistry-Immunofluorescence-NBP2-59028-img0001.jpg "Immunocytochemistry/Immunofluorescence: CEP350 Antibody (CL3423) [NBP2-59028] - Staining of A431 cells using the anti-CEP350 monoclonal antibody, showing specific staining of the centrosome in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: CEP350 Antibody (CL3423) [NBP2-59028] - Staining of U2OS cells using the anti-CEP350 monoclonal antibody, showing specific staining of the centrosome in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CEP350-Antibody-CL3423-Immunocytochemistry-Immunofluorescence-NBP2-59028-img0002.jpg "Immunocytochemistry/Immunofluorescence: CEP350 Antibody (CL3423) [NBP2-59028] - Staining of U2OS cells using the anti-CEP350 monoclonal antibody, showing specific staining of the centrosome in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CEP350 Antibody (CL3423) [NBP2-59028] - Staining of human colon shows centrosome-like positivity in lymphoid cells in lamina propria.](http://images.novusbio.com/fullsize/CEP350-Antibody-CL3423-Immunohistochemistry-Paraffin-NBP2-59028-img0004.jpg "Immunohistochemistry-Paraffin: CEP350 Antibody (CL3423) [NBP2-59028] - Staining of human colon shows centrosome-like positivity in lymphoid cells in lamina propria.")
![Immunohistochemistry-Paraffin: CEP350 Antibody (CL3423) [NBP2-59028] - Staining of human breast cancer shows centrosome-like immunoreactivity in tumor cells.](http://images.novusbio.com/fullsize/CEP350-Antibody-CL3423-Immunohistochemistry-Paraffin-NBP2-59028-img0005.jpg "Immunohistochemistry-Paraffin: CEP350 Antibody (CL3423) [NBP2-59028] - Staining of human breast cancer shows centrosome-like immunoreactivity in tumor cells.")
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")