Our customer would like to have CHI3L1 antibody for testing samples from dog... After searching, none can be found. However, we noticed that the sequence of NBP1-57913 is listed clearly as well as similarities of other species. We wonder if you can help compare with canine CHI3L1 as well.

Name: Chitinase 3-like 1/YKL-40 Antibody
Brand: Novus Biologicals
SKU: NBP1-57913
Price: 399 USD

Question

Our customer would like to have CHI3L1 antibody for testing samples from dog...  After searching, none can be found.  However, we noticed that the sequence of NBP1-57913 is listed clearly as well as similarities of other species.  We wonder if you can help compare with canine CHI3L1 as well.

Accepted Answer

We have five antibodies to CHI3L1, all of which are raised against the human protein. The sequence entry of canine CHI3L1 has not been reviewed in Uniprot, however I ran an alignment for you between this and the human sequence, and found the homology to be 82%. Therefore it is likely, but not confirmed, that antibodies which bind the human protein may recognise canine CHI3L1. The homology between the immunogen sequence used to generate NBP1-57913 and the full length canine sequence is 84%. The homology between the immunogen sequence used to generate NBP1-28610 and the full length canine sequence is 83%. Your customer may be interested in our Innovators Reward Program, which allows them to try our primary antibodies in an untested species or application without the financial risk of failure. They could try one of our CHI3L1 antibodies against canine samples, share their results (including an image) with us, and receive a voucher for 100% of the purchase price of the reviewed product.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, Pm, V-ViSpecies Glossary
Applications	WB, ICC/IF
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated
Concentration	0.5 mg/ml

Description	The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen	Synthetic peptides corresponding to CHI3L1(chitinase 3-like 1 (cartilage glycoprotein-39)) The peptide sequence was selected from the middle region of CHI3L1. Peptide sequence LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL. The peptide sequence for this immunogen was taken from within the described region.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	CHI3L1
Purity	Affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS, 2% Sucrose
Preservative	0.09% Sodium Azide
Concentration	0.5 mg/ml
Purity	Affinity purified

Gene Symbol	CHI3L1
Uniprot	P36222()

Chitinase 3-like 1/YKL-40 Antibody

Species Glossary

Images

Product Details

Order Details

Chitinase 3-like 1/YKL-40 Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Chitinase 3-like 1/YKL-40 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Chitinase 3-like 1/YKL-40 Antibody (NBP1-57913)(1)

Reviews for Chitinase 3-like 1/YKL-40 Antibody (NBP1-57913) (0)

Product General Protocols

Video Protocols

FAQs for Chitinase 3-like 1/YKL-40 Antibody (NBP1-57913). (Showing 1 - 1 of 1 FAQ).

Secondary Antibodies

Isotype Controls

Additional Chitinase 3-like 1/YKL-40 Products

Research Areas for Chitinase 3-like 1/YKL-40 Antibody (NBP1-57913)

Blogs on Chitinase 3-like 1/YKL-40

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics