CDK5 Activator 1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDK |
Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CDK5R1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for CDK5 Activator 1 Antibody
Background
The baculoviruses are a large, diverse family of DNA viruses that have evolved a number of mechanisms to manipulate thier insect hosts. One of these is the ability to regulate apoptosis during infection by expressing proteins that can inhibit caspase activation, including the caspase inhibitor p35 and the inhibitor of apoptosis (IAP) proteins (reviewed in Clem, 2005; Clarke and Clem, 2003; and Iller, 1997). The p35 baculovirus protein strongly inhibits caspase enzymatic activity, and is the the most broadly acting caspase inhibitor protein known. p35 baculovirus forms essentially irreversible complexes with its target caspases in a process that is accompanied by the cleavage of p35, generating two fragments of approximately 10 kDa and 25 kDa. These cleavage fragments remain associated with caspases and thereby block caspase activity. The ability of p35 to inhibit caspases along with the central role of caspases in the apoptotic process enables p35 baculovirus to block apoptosis in a phylogentically broad range of cells, and in response to a wide variety of apoptotic induction signals. For example, over expression of p35 in mammalian, insect, and nematode cells results in resistance to apoptosis. IMG-5740 recognizes p35 baculovirus; p35 baculovirus migrates at ~35 kDa on SDS-PAGE.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for CDK5 Activator 1 Antibody (NBP2-55112) (0)
There are no publications for CDK5 Activator 1 Antibody (NBP2-55112).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CDK5 Activator 1 Antibody (NBP2-55112) (0)
There are no reviews for CDK5 Activator 1 Antibody (NBP2-55112).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CDK5 Activator 1 Antibody (NBP2-55112) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CDK5 Activator 1 Products
Research Areas for CDK5 Activator 1 Antibody (NBP2-55112)
Find related products by research area.
|
Blogs on CDK5 Activator 1