Orthogonal Strategies: Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody (CL1673) [NBP2-34488] - Staining in human tonsil and cerebral cortex tissues. Corresponding CD40 RNA-seq data are presented for the same ...read more
Western Blot: CD40/TNFRSF5 Antibody (CL1673) [NBP2-34488] - Lane 1: Marker [kDa] Lane 2: Human spleen
Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody (CL1673) [NBP2-34488] - Human stomach cancer FFPE block stained with CD40 antibody at 1:6000 overnight. Antigen retrieval at pH 9. IHC-P image submitted by a verified ...read more
Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody (CL1673) [NBP2-34488] - Staining of human tonsil shows strong membranous positivity in germinal center cells.
Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody (CL1673) [NBP2-34488] - Staining of human colon shows moderate membranous positivity in lymphoid cells.
Immunohistochemistry-Paraffin: CD40/TNFRSF5 Antibody (CL1673) [NBP2-34488] - Staining of human cerebral cortex shows no positivity in neuronal cells as expected.
This antibody was developed against a recombinant protein corresponding to amino acids: KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCE
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
CD40
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
TNFRSF5CD40 antigen (TNF receptor superfamily member 5)
tumor necrosis factor receptor superfamily member 5
tumor necrosis factor receptor superfamily, member 5
Background
CD40 and its ligand CD154 are members of the tumor necrosis factor receptor (TNFR) and TNF families, respectively, that play key roles in signaling pathways mediating cell growth, survival and differentiation in B-lymphocytes (reviewed in Quezada et al 2004). The CD40 receptor is a 45-50 kDa glycoprotein and is expressed on the surface of B-lymphocytes, some activated T-cells, monocytes, follicular dendritic cells, basal epithelial cells, and in some epithelial and non-epithelial carcinomas. The functions of CD40 have been most extensively studied in B-cells. Ligation of B CD40 by CD154, expressed on activated T cells, stimulates B cell proliferation, differentiation, isotype switching, upregulation of surface molecules contributing to antigen presentation, development of the germinal center, and the humoral memory response. Several distinct structural motifs in the CD40 cytoplasmic domain regaulate various CD40 signaling pathways. A major CD40 signaling pathway activated from CD154 ligand binding is the canonical pathway to the transcription factor family NF-kB, a family of genes mediating immune and inflammatory responses. Although CD40 has been extensively studied as a plasma membrane-associated growth factor membrane receptor. it has also been identified in the cytoplasm and nucleus of normal and neoplastic B-lymphoid cells (Lin-Lee et al. 2006). Other growth factor receptors, including EGF, FGF, and TGF-B have also been identified in the nuclus. It is thought that plasma membrane receptor signaling may be followed by nuclear migration of signaling pathway components. The presence of CD40 in the nucleus of activated normal B lymphocytes and neoplastic B-lymphoid cells suggests that CD40 may play a more complex role in regulating essential growth and survival pathways in B-lymphocytes than previously thought.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for CD40/TNFRSF5 Antibody (NBP2-34488). (Showing 1 - 2 of 2 FAQ).
I wanna know does CD40 antibody for IHC-P comes with positive control slide?
Our CD40 antibodies do not come with positive control slides however you can use any type of primary carcinoma cell as a positive control. I recommend breast carcinoma as this is what we have tested our CD40 antibodies on.
We are studying CD40L in our system. It has been known that both CD40 and CD11b are receptors for CD40L. We need CD40 antibody to neutralize CD40 binding to CD40L, then we may prove what is function for CD11b binding to CD40L. Do you have any CD40 Ab which has block function only between CD40 and CD40L, but not between CD11b and CD40L?
Unfortunately, none of our CD40 antibodies have been specifically tested for this application.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.