![Simple Western: CD3 gamma Antibody [NBP2-32636] - Simple Western lane view shows a specific band for CD3G in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/CD3-gamma-Antibody-Simple-Western-NBP2-32636-img0004.jpg "Simple Western: CD3 gamma Antibody [NBP2-32636] - Simple Western lane view shows a specific band for CD3G in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CD3G |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets-1_AF7284_Western_Blot_11854.jpg)
![Immunohistochemistry Ets-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ets1_AF7284_Immunohistochemistry_22698.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CD3 gamma Antibody (NBP2-32636)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CD3G |
![Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining in human lymph node and small intestine tissues . Corresponding CD3G RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CD3-gamma-Antibody-Immunohistochemistry-Paraffin-NBP2-32636-img0012.jpg "Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining in human lymph node and small intestine tissues . Corresponding CD3G RNA-seq data are presented for the same tissues.")
![Western Blot: CD3 gamma Antibody [NBP2-32636] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MOLT-4](http://images.novusbio.com/fullsize/CD3-gamma-Antibody-Western-Blot-NBP2-32636-img0006.jpg "Western Blot: CD3 gamma Antibody [NBP2-32636] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MOLT-4")
![Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human granular layer of the cerebellum shows no cytoplasmic positivity as expected.](http://images.novusbio.com/fullsize/CD3-gamma-Antibody-Immunohistochemistry-Paraffin-NBP2-32636-img0008.jpg "Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human granular layer of the cerebellum shows no cytoplasmic positivity as expected.")
![Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human lymph node shows moderate to strong positivity.](http://images.novusbio.com/fullsize/CD3-gamma-Antibody-Immunohistochemistry-Paraffin-NBP2-32636-img0009.jpg "Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human lymph node shows moderate to strong positivity.")
![Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human small intestine shows moderate to strong positivity in lymphoid cells.](http://images.novusbio.com/fullsize/CD3-gamma-Antibody-Immunohistochemistry-Paraffin-NBP2-32636-img0010.jpg "Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human small intestine shows moderate to strong positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human spleen shows moderate to strong positivity.](http://images.novusbio.com/fullsize/CD3-gamma-Antibody-Immunohistochemistry-Paraffin-NBP2-32636-img0011.jpg "Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human spleen shows moderate to strong positivity.")
![Simple Western: CD3 gamma Antibody [NBP2-32636] - Electropherogram image of the corresponding Simple Western lane view. CD3G antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.](http://images.novusbio.com/fullsize/CD3-gamma-Antibody-Simple-Western-NBP2-32636-img0005.jpg "Simple Western: CD3 gamma Antibody [NBP2-32636] - Electropherogram image of the corresponding Simple Western lane view. CD3G antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.")
![Flow Cytometry TCR gamma/delta Antibody (GL-3) [Unconjugated]](https://images.novusbio.com/images2/TCR_gamma_delta_MAB7297_Flow_Cytometry_11892.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")