c-Maf Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human c-Maf (NP_005351). Peptide sequence DAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWK |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MAF |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
Theoretical MW |
42 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for c-Maf Antibody
Background
c-Maf is part of the Maf family of transcription factors that possess a conserved basic region and a leucine zipper domain that mediate DNA and protein-protein binding and plays an important role in tissue-specific gene regulation and cell differentiation. c-Maf is a transcriptional activator of interleukin 4 and 10 in T-cells, and is involved in lens fiber cell differentiation. c-Maf translocation has been observed in human multiple myeloma and may be oncogenic.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Rt
Applications: ICC, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC, ICFlow, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
Publications for c-Maf Antibody (NBP3-10482) (0)
There are no publications for c-Maf Antibody (NBP3-10482).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for c-Maf Antibody (NBP3-10482) (0)
There are no reviews for c-Maf Antibody (NBP3-10482).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for c-Maf Antibody (NBP3-10482) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional c-Maf Products
Research Areas for c-Maf Antibody (NBP3-10482)
Find related products by research area.
|
Blogs on c-Maf