![Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining in human bone marrow and liver tissues . Corresponding NFE2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Nuclear-Factor-Erythroid-Derived-2-Antibody-Immunohistochemistry-Paraffin-NBP1-82580-img0017.jpg "Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining in human bone marrow and liver tissues . Corresponding NFE2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPES |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NFE2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. br/>In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NFE2 |
![Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Analysis in control (vector only transfected HEK293T lysate) and NFE2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Nuclear-Factor-Erythroid-Derived-2-Antibody-Western-Blot-NBP1-82580-img0019.jpg "Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Analysis in control (vector only transfected HEK293T lysate) and NFE2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Analysis in human cell line HEL.](http://images.novusbio.com/fullsize/Nuclear-Factor-Erythroid-Derived-2-Antibody-Western-Blot-NBP1-82580-img0018.jpg "Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Analysis in human cell line HEL.")
![Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human bone marrow shows moderate to strong nuclear positivity in hematopoietic cells.](http://images.novusbio.com/fullsize/Nuclear-Factor-Erythroid-Derived-2-Antibody-Immunohistochemistry-Paraffin-NBP1-82580-img0014.jpg "Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human bone marrow shows moderate to strong nuclear positivity in hematopoietic cells.")
![Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Nuclear-Factor-Erythroid-Derived-2-Antibody-Immunohistochemistry-Paraffin-NBP1-82580-img0015.jpg "Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Nuclear-Factor-Erythroid-Derived-2-Antibody-Immunohistochemistry-Paraffin-NBP1-82580-img0016.jpg "Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.")
![Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Simple Western lane view shows a specific band for NFE2 in 0.2 mg/ml of K-562 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/Nuclear-Factor-Erythroid-Derived-2-Antibody-Simple-Western-NBP1-82580-img0006.jpg "Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Simple Western lane view shows a specific band for NFE2 in 0.2 mg/ml of K-562 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Electropherogram image(s) of corresponding Simple Western lane view. Nuclear Factor Erythroid Derived 2 antibody was used at 1:20 dilution on K-562 lysate(s).](http://images.novusbio.com/fullsize/Nuclear-Factor-Erythroid-Derived-2-Antibody-Simple-Western-NBP1-82580-img0007.jpg "Simple Western: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Electropherogram image(s) of corresponding Simple Western lane view. Nuclear Factor Erythroid Derived 2 antibody was used at 1:20 dilution on K-562 lysate(s).")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Bioactivity Thrombopoietin/THPO [Unconjugated]](https://images.novusbio.com/images/protein/288-tpncf_recombinant-human-thrombopoietin-ns0-expressed-protein-cf-bioactivity-272020135047.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")