Home » Blooms Syndrome Protein Blm » Blooms Syndrome Protein Blm Proteins » Recombinant Human Blooms Syndrome Protein Blm GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Blooms Syndrome Protein Blm GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human Blooms Syndrome Protein Blm Protein [H00000641-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human Blooms Syndrome Protein Blm Protein [H00000641-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Blooms Syndrome Protein Blm GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1196-1295 of Human Blooms Syndrome Protein Blm

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
BLM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Blooms Syndrome Protein Blm GST (N-Term) Protein

  • BLM
  • Bloom syndrome
  • Bloom syndrome, RecQ helicase-like
  • Blooms Syndrome Protein Blm
  • BSBloom syndrome protein
  • DNA helicase, RecQ-like type 2
  • EC 3.6.1
  • EC 3.6.4.12
  • MGC126616
  • MGC131618
  • RecQ protein-like 3
  • RecQ2
  • RECQ2MGC131620
  • RECQL3
  • RECQL3RECQL2

Background

BLM - Bloom syndrome

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

WRN Antibody
NB100-471
Immunoprecipitation WRN Antibody
Western Blot WRN Antibody
Immunocytochemistry/ Immunofluorescence WRN Antibody
(2 Reviews)
(13 Publications)
Species: Hu
Applications: ChIP, ICC/IF, IHC, IP, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Osteocalcin
Antibody (190125)
MAB1419
Intracellular Staining by Flow Cytometry Osteocalcin Antibody (190125)
Intracellular Staining by Flow Cytometry Osteocalcin Antibody (190125)
Immunocytochemistry Osteocalcin Antibody (190125)
(3 Reviews)
(56 Publications)
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
RECQ1 Antibody
NB100-619
Immunoprecipitation RECQ1 Antibody
Immunohistochemistry RECQ1 Antibody
Western Blot RECQ1 Antibody
(3 Reviews)
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
Rad51 Antibody
(14B4)
NB100-148
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
(5 Reviews)
(63 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
PTH Antibody
(918462) [Unconjugate
MAB7665
Immunohistochemistry PTH Antibody (918462) [Unconjugated]
Western Blot PTH Antibody (918462) [Unconjugated]
Species: Hu
Applications: IHC, WB
RECQL4 Antibody
NBP2-47310
Western Blot RECQL4 Antibody
Immunocytochemistry/ Immunofluorescence RECQL4 Antibody
Immunohistochemistry-Paraffin RECQL4 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MID1 Antibody -
BSA Free
NBP3-05061
Immunocytochemistry/ Immunofluorescence MID1 Antibody - BSA Free
Western Blot MID1 Antibody - BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(656 Publications)
Species: Mu
Applications: ELISA
IRF1 Antibody
AF4715
Western Blot IRF1 Antibody
(1 Review)
(2 Publications)
Species: Mu
Applications: WB
ATM Antibody (2C1)
NB100-309
Knockdown Validated ATM Antibody (2C1)
Knockdown Validated ATM Antibody (2C1)
Immunoprecipitation ATM Antibody (2C1)
(3 Reviews)
(131 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
TFF2 Antibody
(366508) [Unconjugate
MAB4077
Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
Adrenomedullin/ADM
Antibody [Unconjugate ...
AF6108
Immunohistochemistry Adrenomedullin/ADM Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC
BLAP75 Antibody
NB100-1720
Immunohistochemistry-Paraffin BLAP75 Antibody
Western Blot BLAP75 Antibody
Western Blot BLAP75 Antibody
(6 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot KRAS Antibody (3B10-2F2)
Western Blot KRAS Antibody (3B10-2F2)
Western Blot KRAS Antibody (3B10-2F2)
(1 Review)
(17 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Nucleostemin
Antibody [Unconjugate
AF1638
Immunocytochemistry Nucleostemin Antibody [Unconjugated]
Simple Western Nucleostemin Antibody [Unconjugated]
Western Blot Nucleostemin Antibody [Unconjugated]
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01) (0)

There are no publications for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01) (0)

There are no reviews for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Blooms Syndrome Protein Blm Products

Research Areas for Blooms Syndrome Protein Blm Partial Recombinant Protein (H00000641-Q01)

Find related products by research area.

Blogs on Blooms Syndrome Protein Blm

There are no specific blogs for Blooms Syndrome Protein Blm, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunohistochemistry-Paraffin: Blooms Syndrome Protein Blm Antibody [NBP1-89929] - Staining of human stomach shows strong nuclear positivity in glandular cells.
Blooms Syndrome Protein Blm Antibody
NBP1-89929

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Blooms Syndrome Protein Blm GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol BLM