![Western Blot: BHMT2 Antibody [NBP1-85826] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate](http://images.novusbio.com/fullsize/BHMT2-Antibody-Western-Blot-NBP1-85826-img0007.jpg "Western Blot: BHMT2 Antibody [NBP1-85826] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVAGGICQTSIYKYQKDEA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BHMT2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BHMT2 |
![Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826] - Staining in human kidney and lymph node tissues using anti-BHMT2 antibody. Corresponding BHMT2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/BHMT2-Antibody-Immunohistochemistry-Paraffin-NBP1-85826-img0010.jpg "Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826] - Staining in human kidney and lymph node tissues using anti-BHMT2 antibody. Corresponding BHMT2 RNA-seq data are presented for the same tissues.")
![Western Blot: BHMT2 Antibody [NBP1-85826] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/BHMT2-Antibody-Western-Blot-NBP1-85826-img0006.jpg "Western Blot: BHMT2 Antibody [NBP1-85826] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/BHMT2-Antibody-Immunohistochemistry-Paraffin-NBP1-85826-img0008.jpg "Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/BHMT2-Antibody-Immunohistochemistry-Paraffin-NBP1-85826-img0009.jpg "Immunohistochemistry-Paraffin: BHMT2 Antibody [NBP1-85826] - Staining of human lymph node shows low expression as expected.")
![N/A Angiopoietin-2 [HRP]](https://images.novusbio.com/images2/Angiopoietin-2_DANG20_ELISA_30.jpg)
![N/A Angiopoietin-2 [HRP]](https://images.novusbio.com/images2/DATA_Angiopoietin2_DANG20_ELISA_574.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")