![Western Blot: Reduced Folate Carrier/SLC19A1 Antibody [NBP1-59904] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.](http://images.novusbio.com/fullsize/Reduced-Folate-Carrier-SLC19A1-Antibody-Western-Blot-NBP1-59904-img0003.jpg "Western Blot: Reduced Folate Carrier/SLC19A1 Antibody [NBP1-59904] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to SLC19A1(solute carrier family 19 (folate transporter), member 1) The peptide sequence was selected from the N terminal of SLC19A1.
Peptide sequence MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC19A1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
![Western Blot Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Western-Blot-NBP2-24457-img0001.jpg)
![Immunohistochemistry-Paraffin Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Immunohistochemistry-Paraffin-NBP2-24457-img0003.jpg)
![Western Blot Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Western-Blot-NBP2-24457-img0005.jpg)
![Flow Cytometry FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Flow_Cytometry_10781.jpg)
![Western Blot FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Western_Blot_6248.jpg)
![Immunocytochemistry FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Immunocytochemistry_6624.jpg)
| Publication using NBP1-59904 | Applications | Species |
|---|---|---|
| Yamashita K, Kiyonari S, Tsubota S et al. Thymidylate synthase inhibitor raltitrexed can induce high levels of DNA damage in MYCN-amplified neuroblastoma cells Cancer Science 2020-07-01 [PMID: 32415892] (Western Blot, Block/Neutralize) | Western Blot, Block/Neutralize |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Reduced Folate Carrier/SLC19A1 Antibody [NBP1-59904] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://images.novusbio.com/fullsize/Reduced-Folate-Carrier-SLC19A1-Antibody-Immunohistochemistry-Paraffin-NBP1-59904-img0002.jpg "Immunohistochemistry-Paraffin: Reduced Folate Carrier/SLC19A1 Antibody [NBP1-59904] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.")
![Western Blot PP2A alpha [p Tyr307] Antibody [Unconjugated]](https://images.novusbio.com/images2/PP2A_AF3989_Western_Blot_5373.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")