![Western Blot: Choline dehydrogenase Antibody [NBP2-92326] - Analysis of extracts of various cell lines, using Choline dehydrogenase at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 3s.](http://images.novusbio.com/fullsize/Choline-dehydrogenase-Antibody-Western-Blot-NBP2-92326-img0001.jpg "Western Blot: Choline dehydrogenase Antibody [NBP2-92326] - Analysis of extracts of various cell lines, using Choline dehydrogenase at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 3s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 245-594 of human CHDH (NP_060867.2). LHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSAQKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAYQVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAPFRGKELQPGSHIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGQPALWDKDVPVYKPRTLATQR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHDH |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 65 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Choline dehydrogenase Antibody (NBP2-92326)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CHDH |
![Immunohistochemistry-Paraffin: Choline dehydrogenase Antibody [NBP2-92326] - Human colon using CHDH Rabbit pAb at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/Choline-dehydrogenase-Antibody-Immunohistochemistry-Paraffin-NBP2-92326-img0004.jpg "Immunohistochemistry-Paraffin: Choline dehydrogenase Antibody [NBP2-92326] - Human colon using CHDH Rabbit pAb at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: Choline dehydrogenase Antibody [NBP2-92326] - Mouse kidney using CHDH Rabbit pAb at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/Choline-dehydrogenase-Antibody-Immunohistochemistry-Paraffin-NBP2-92326-img0002.jpg "Immunohistochemistry-Paraffin: Choline dehydrogenase Antibody [NBP2-92326] - Mouse kidney using CHDH Rabbit pAb at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: Choline dehydrogenase Antibody [NBP2-92326] - Rat kidney using CHDH Rabbit pAb at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/Choline-dehydrogenase-Antibody-Immunohistochemistry-Paraffin-NBP2-92326-img0003.jpg "Immunohistochemistry-Paraffin: Choline dehydrogenase Antibody [NBP2-92326] - Rat kidney using CHDH Rabbit pAb at dilution of 1:100 (40x lens).")
![Chordin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Chordin [Unconjugated]")
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images/mab2476_human-brca2-mab-clone-234403-2282024172111.jpg)
![Immunohistochemistry Crossveinless-2/CV-2/BMPER Antibody [Unconjugated]](https://images.novusbio.com/images2/Crossveinless-2_AF2299_Immunohistochemistry_10691.jpg)
![Immunocytochemistry/ Immunofluorescence Crossveinless-2/CV-2/BMPER Antibody [Unconjugated]](https://images.novusbio.com/images/af2299_mouse-crossveinless-2-affinity-purified-polyclonal-ab-41202412405112.jpg)
![Immunocytochemistry/ Immunofluorescence Crossveinless-2/CV-2/BMPER Antibody [Unconjugated]](https://images.novusbio.com/images/af2299_mouse-crossveinless-2-affinity-purified-polyclonal-ab-41202412403561.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")