![Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining in human kidney and lymph node tissues using anti-BHMT antibody. Corresponding BHMT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/BHMT-Antibody-Immunohistochemistry-Paraffin-NBP1-88611-img0009.jpg "Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining in human kidney and lymph node tissues using anti-BHMT antibody. Corresponding BHMT RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKVFLQQLEVFIKKNVD |
| Predicted Species | Mouse (92%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BHMT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for BHMT Antibody (NBP1-88611)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BHMT |
![Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human cerebral cortex, colon, kidney and testis using Anti-BHMT antibody NBP1-88611 (A) shows similar protein distribution across tissues to independent antibody NBP2-38850 (B).](http://images.novusbio.com/fullsize/BHMT-Antibody-Immunohistochemistry-Paraffin-NBP1-88611-img0010.jpg "Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human cerebral cortex, colon, kidney and testis using Anti-BHMT antibody NBP1-88611 (A) shows similar protein distribution across tissues to independent antibody NBP2-38850 (B).")
![Western Blot: BHMT Antibody [NBP1-88611] - Analysis using Anti-BHMT antibody NBP1-88611 (A) shows similar pattern to independent antibody NBP2-38850 (B).](http://images.novusbio.com/fullsize/BHMT-Antibody-Western-Blot-NBP1-88611-img0011.jpg "Western Blot: BHMT Antibody [NBP1-88611] - Analysis using Anti-BHMT antibody NBP1-88611 (A) shows similar pattern to independent antibody NBP2-38850 (B).")
![Immunocytochemistry/Immunofluorescence: BHMT Antibody [NBP1-88611] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/BHMT-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88611-img0006.jpg "Immunocytochemistry/Immunofluorescence: BHMT Antibody [NBP1-88611] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human kidney using Anti-BHMT antibody NBP1-88611.](http://images.novusbio.com/fullsize/BHMT-Antibody-Immunohistochemistry-Paraffin-NBP1-88611-img0016.jpg "Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human kidney using Anti-BHMT antibody NBP1-88611.")
![Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/BHMT-Antibody-Immunohistochemistry-Paraffin-NBP1-88611-img0007.jpg "Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/BHMT-Antibody-Immunohistochemistry-Paraffin-NBP1-88611-img0008.jpg "Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human colon using Anti-BHMT antibody.](http://images.novusbio.com/fullsize/BHMT-Antibody-Immunohistochemistry-Paraffin-NBP1-88611-img0013.jpg "Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human colon using Anti-BHMT antibody.")
![Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human cerebral cortex using Anti-BHMT antibody.](http://images.novusbio.com/fullsize/BHMT-Antibody-Immunohistochemistry-Paraffin-NBP1-88611-img0014.jpg "Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human cerebral cortex using Anti-BHMT antibody.")
![Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human testis using Anti-BHMT antibody.](http://images.novusbio.com/fullsize/BHMT-Antibody-Immunohistochemistry-Paraffin-NBP1-88611-img0015.jpg "Immunohistochemistry-Paraffin: BHMT Antibody [NBP1-88611] - Staining of human testis using Anti-BHMT antibody.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")