![Immunohistochemistry-Paraffin: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Analysis in human placenta and pancreas tissues using NBP2-48534 antibody. Corresponding TGFBI RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Beta-Ig-h3-TGFBI-Antibody-Immunohistochemistry-Paraffin-NBP2-48534-img0022.jpg "Immunohistochemistry-Paraffin: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Analysis in human placenta and pancreas tissues using NBP2-48534 antibody. Corresponding TGFBI RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NREGVYTVFAPTNEAFRALPPRERSRLLGDAKELANILKYHIGDEILVSGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSALEIFKQAS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TGFBI |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Beta Ig-h3/TGFBI Antibody (NBP2-48534)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TGFBI |
![Immunohistochemistry-Paraffin: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Staining of human gastrointestinal, pancreas, placenta and skin using Anti-Beta Ig-h3/TGFBI antibody NBP2-48534 (A) shows similar protein distribution across tissues to independent antibody NBP1-88606 (B).](http://images.novusbio.com/fullsize/Beta-Ig-h3-TGFBI-Antibody-Immunohistochemistry-Paraffin-NBP2-48534-img0015.jpg "Immunohistochemistry-Paraffin: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Staining of human gastrointestinal, pancreas, placenta and skin using Anti-Beta Ig-h3/TGFBI antibody NBP2-48534 (A) shows similar protein distribution across tissues to independent antibody NBP1-88606 (B).")
![Western Blot: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Analysis in human plasma.](http://images.novusbio.com/fullsize/Beta-Ig-h3-TGFBI-Antibody-Western-Blot-NBP2-48534-img0009.jpg "Western Blot: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Analysis in human plasma.")
![Immunohistochemistry-Paraffin: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Staining of human eye shows moderate extracellular positivity in cornea.](http://images.novusbio.com/fullsize/Beta-Ig-h3-TGFBI-Antibody-Immunohistochemistry-Paraffin-NBP2-48534-img0016.jpg "Immunohistochemistry-Paraffin: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Staining of human eye shows moderate extracellular positivity in cornea.")
![Immunohistochemistry-Paraffin: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Beta-Ig-h3-TGFBI-Antibody-Immunohistochemistry-Paraffin-NBP2-48534-img0017.jpg "Immunohistochemistry-Paraffin: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Staining of human placenta shows moderate positivity in extracellular matrix of trophoblastic cells.](http://images.novusbio.com/fullsize/Beta-Ig-h3-TGFBI-Antibody-Immunohistochemistry-NBP2-48534-img0018.jpg "Immunohistochemistry: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Staining of human placenta shows moderate positivity in extracellular matrix of trophoblastic cells.")
![Immunohistochemistry-Paraffin: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Staining of human rectum shows moderate positivity in extracellular matrix of glandular cells.](http://images.novusbio.com/fullsize/Beta-Ig-h3-TGFBI-Antibody-Immunohistochemistry-Paraffin-NBP2-48534-img0019.jpg "Immunohistochemistry-Paraffin: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Staining of human rectum shows moderate positivity in extracellular matrix of glandular cells.")
![Immunohistochemistry-Paraffin: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Staining of human skin shows moderate positivity in extracellular matrix in dermis.](http://images.novusbio.com/fullsize/Beta-Ig-h3-TGFBI-Antibody-Immunohistochemistry-Paraffin-NBP2-48534-img0020.jpg "Immunohistochemistry-Paraffin: Beta Ig-h3/TGFBI Antibody [NBP2-48534] - Staining of human skin shows moderate positivity in extracellular matrix in dermis.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Western Blot Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Western_Blot_5130.jpg)
![Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Immunocytochemistry__Immunofluorescence_18847.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot TROP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/TROP-2_AF650_Western_Blot_12086.jpg)
![Immunohistochemistry TROP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/TROP-2_AF650_Immunohistochemistry_7209.jpg)
![Flow Cytometry TROP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/TROP-2_AF650_Flow_Cytometry_9384.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")