Home » WDHD1 » WDHD1 Antibodies » WDHD1 Antibody
Novus Biologicals products are now on bio-techne.com

WDHD1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: WDHD1 Antibody [NBP2-86065] - WB Suggested Anti-WDHD1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Hela cell lysate
Western Blot: WDHD1 Antibody [NBP2-86065] - WB Suggested Anti-WDHD1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Hela cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

WDHD1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human WDHD1. Peptide sequence: KRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
WDHD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for WDHD1 Antibody

  • Acidic nucleoplasmic DNA-binding protein 1
  • AND1
  • AND-1
  • CHTF4
  • CTF4
  • CTF4, chromosome transmission fidelity factor 4 homolog
  • WD repeat and HMG-box DNA binding protein 1
  • WD repeat and HMG-box DNA-binding protein 1

Background

WDHD1 is encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CHTF18 Antibody
(1F5)
H00063922-M01
Sandwich ELISA CHTF18 Antibody (1F5)
Western Blot CHTF18 Antibody (1F5)
Western Blot CHTF18 Antibody (1F5)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
MCM10 Antibody
NBP1-92102
Western Blot MCM10 Antibody
Immunohistochemistry-Paraffin MCM10 Antibody
Immunohistochemistry-Paraffin MCM10 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MCM7 Antibody (6C2)
H00004176-M01
Western Blot MCM7 Antibody (6C2)
ELISA MCM7 Antibody (6C2)
Proximity Ligation Assay MCM7 Antibody (6C2)
(5 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
CDC45L Antibody
NBP1-85723
Western Blot CDC45L Antibody
Immunohistochemistry-Paraffin CDC45L Antibody
Immunohistochemistry-Paraffin CDC45L Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Chk1 Antibody
NB100-464
Immunoprecipitation Chk1 Antibody
Immunohistochemistry-Paraffin Chk1 Antibody
Western Blot Chk1 Antibody
(12 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
MMR/CD206/Mannose
Receptor Antibody [Un ...
AF2535
Immunohistochemistry MMR/CD206/Mannose Receptor Antibody [Unconjugated]
Western Blot MMR/CD206/Mannose Receptor Antibody [Unconjugated]
Immunohistochemistry MMR/CD206/Mannose Receptor Antibody [Unconjugated]
(2 Reviews)
(193 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/ Immunofluorescence PCNA Antibody (PC10)
Western Blot PCNA Antibody (PC10)
Flow Cytometry PCNA Antibody (PC10)
(5 Reviews)
(46 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Histone H3
Antibody - BSA Free
NB500-171
Immunohistochemistry-Paraffin Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
(8 Reviews)
(34 Publications)
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
ATR Antibody (2B5)
NB100-308
Immunocytochemistry/ Immunofluorescence ATR Antibody (2B5)
Western Blot ATR Antibody (2B5)
Western Blot ATR Antibody (2B5)
(21 Publications)
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
CDT2 Antibody
NB100-40840
Immunoprecipitation CDT2 Antibody
Western Blot CDT2 Antibody
Immunohistochemistry-Paraffin CDT2 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
MCM2 Antibody
NB100-288
Western Blot MCM2 Antibody
Immunoprecipitation MCM2 Antibody
Immunohistochemistry-Paraffin MCM2 Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Rad21 Antibody
NBP2-20053
Immunohistochemistry-Paraffin Rad21 Antibody
Immunohistochemistry-Paraffin Rad21 Antibody
Immunocytochemistry/ Immunofluorescence Rad21 Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Reduced Folate
Carrier/SLC19A1 Antib
NBP1-59904
Immunohistochemistry-Paraffin Reduced Folate Carrier/SLC19A1 Antibody
Western Blot Reduced Folate Carrier/SLC19A1 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
RFC1 Antibody
[Unconjugated]
AF6457
Western Blot RFC1 Antibody [Unconjugated]
Species: Hu
Applications: WB
DDX11 Antibody
(3C1)
H00001663-M03
Western Blot DDX11 Antibody (3C1)
Immunocytochemistry/ Immunofluorescence DDX11 Antibody (3C1)
Immunohistochemistry-Paraffin DDX11 Antibody (3C1)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
CDC7 Antibody
NBP2-32708
Immunohistochemistry-Paraffin CDC7 Antibody
Immunohistochemistry-Paraffin CDC7 Antibody
Immunohistochemistry-Paraffin CDC7 Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
KAT2A/GCN5 Antibody
NBP3-37988
Immunohistochemistry KAT2A/GCN5 Antibody
Immunohistochemistry KAT2A/GCN5 Antibody
Immunocytochemistry/ Immunofluorescence KAT2A/GCN5 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
CHL-1/L1CAM-2
Antibody [Unconjugate
AF2147
Western Blot CHL-1/L1CAM-2 Antibody [Unconjugated]
Simple Western CHL-1/L1CAM-2 Antibody [Unconjugated]
Western Blot CHL-1/L1CAM-2 Antibody [Unconjugated]
(1 Review)
(25 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
DNA2 Antibody
NBP1-85006
Immunohistochemistry-Paraffin DNA2 Antibody
Species: Hu
Applications: IHC, IHC-P
WDHD1 Antibody
NBP2-86065
WDHD1 Antibody
Species: Hu
Applications: WB

Publications for WDHD1 Antibody (NBP2-86065) (0)

There are no publications for WDHD1 Antibody (NBP2-86065).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDHD1 Antibody (NBP2-86065) (0)

There are no reviews for WDHD1 Antibody (NBP2-86065). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDHD1 Antibody (NBP2-86065) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDHD1 Products

Array NBP2-86065

Research Areas for WDHD1 Antibody (NBP2-86065)

Find related products by research area.

Blogs on WDHD1

There are no specific blogs for WDHD1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDHD1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol WDHD1