![Western Blot: Von Willebrand Factor Antibody (CL1957) [NBP2-34494] - Lane 1: Marker [kDa]. Lane 2: Human spleen tissue lysate](http://images.novusbio.com/fullsize/Von-Willebrand-Factor-Antibody-CL1957-Western-Blot-NBP2-34494-img0007.jpg "Western Blot: Von Willebrand Factor Antibody (CL1957) [NBP2-34494] - Lane 1: Marker [kDa]. Lane 2: Human spleen tissue lysate")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clone | CL1957 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCDRGLRPSCPNSQSPVKVEKT |
| Epitope | MDEDGNEKRPGDVWT |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | VWF |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Immunohistochemistry_10287.jpg)
![Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Flow_Cytometry_16017.jpg)
![Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Immunohistochemistry_21486.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Von Willebrand Factor Antibody (NBP2-34494)Find related products by research area.
|
|
Thrombomodulin - A multifunctional protein with roles in inflammation and coagulation Thrombomodulin, also known as BDCA-3, is a glycosylated transmembrane protein present on the surface of vascular endothelial cells. Thrombomodulin is a high-affinity receptor for thrombin, a key protein in the coagulation cascade. Formation of the... Read full blog post. |
|
Von Willebrand Factor: An important mediator and carrier of hemostasis Human Von Willebrand Factor (factor VIII R: Ag) is a 270 kDa multimeric plasma gylcoprotein. Important in the maintenance of hemostasis, it mediates platelet adhesion to injured vessel walls and serves as a carrier and stabilizer for coagulation facto... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Von Willebrand Factor Antibody (CL1957) [NBP2-34494] - Staining of human tonsil shows absence of immunoreactivity in lymphoid cells (negative control).](http://images.novusbio.com/fullsize/Von-Willebrand-Factor-Antibody-CL1957-Immunohistochemistry-Paraffin-NBP2-34494-img0012.jpg "Immunohistochemistry-Paraffin: Von Willebrand Factor Antibody (CL1957) [NBP2-34494] - Staining of human tonsil shows absence of immunoreactivity in lymphoid cells (negative control).")
![Immunohistochemistry-Paraffin: Von Willebrand Factor Antibody (CL1957) [NBP2-34494] - Staining of human rectum shows strong immunoreactivity in a blood vessel.](http://images.novusbio.com/fullsize/Von-Willebrand-Factor-Antibody-CL1957-Immunohistochemistry-Paraffin-NBP2-34494-img0008.jpg "Immunohistochemistry-Paraffin: Von Willebrand Factor Antibody (CL1957) [NBP2-34494] - Staining of human rectum shows strong immunoreactivity in a blood vessel.")
![Immunohistochemistry-Paraffin: Von Willebrand Factor Antibody (CL1957) [NBP2-34494] - Staining of human fallopian tube shows strong positivity in blood vessels.](http://images.novusbio.com/fullsize/Von-Willebrand-Factor-Antibody-CL1957-Immunohistochemistry-Paraffin-NBP2-34494-img0009.jpg "Immunohistochemistry-Paraffin: Von Willebrand Factor Antibody (CL1957) [NBP2-34494] - Staining of human fallopian tube shows strong positivity in blood vessels.")
![Immunohistochemistry-Paraffin: Von Willebrand Factor Antibody (CL1957) [NBP2-34494] - Staining of human cerebral cortex shows strong immunoreactivity in blood vessels.](http://images.novusbio.com/fullsize/Von-Willebrand-Factor-Antibody-CL1957-Immunohistochemistry-Paraffin-NBP2-34494-img0010.jpg "Immunohistochemistry-Paraffin: Von Willebrand Factor Antibody (CL1957) [NBP2-34494] - Staining of human cerebral cortex shows strong immunoreactivity in blood vessels.")
![Immunohistochemistry-Paraffin: Von Willebrand Factor Antibody (CL1957) [NBP2-34494] - Staining of human testis shows strong positivity in larger and smaller blood vessels.](http://images.novusbio.com/fullsize/Von-Willebrand-Factor-Antibody-CL1957-Immunohistochemistry-Paraffin-NBP2-34494-img0011.jpg "Immunohistochemistry-Paraffin: Von Willebrand Factor Antibody (CL1957) [NBP2-34494] - Staining of human testis shows strong positivity in larger and smaller blood vessels.")
![N/A ADAMTS13 [HRP]](https://images.novusbio.com/images2/ADAMTS13_DADT130_ELISA_24.jpg)
![N/A ADAMTS13 [HRP]](https://images.novusbio.com/images2/DATA_ADAMTS13_DADT130_ELISA_565.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![N/A t-Plasminogen Activator/tPA [HRP]](https://images.novusbio.com/images2/DATA_tPlasminogen_Activator_DTPA00_ELISA_854.jpg)
![N/A t-Plasminogen Activator/tPA [HRP]](https://images.novusbio.com/images2/tPlasminogen_Activator_DTPA00_ELISA_510.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Immunocytochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombomodulin_AF3894_Immunocytochemistry__Immunofluorescence_17780.jpg)
![Immunohistochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombomodulin_AF3894_Immunohistochemistry_24179.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")