VAMP-2 Antibody (8X9D9) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VAMP-2 (P63027). MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILG |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
VAMP2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for VAMP-2 Antibody (8X9D9)
Background
Vesicle-associated membrane protein (VAMP), also known as synaptobrevin, is an 18 kDa integral membrane protein localized to the cytoplasmic surface of synaptic vesicle (2). VAMP consists of a proline-rich amino-terminal region, a highly conserved hydrophilic domain, followed by a transmembrane anchor and a carboxylterminal tail (3). Two VAMP homologs, VAMP1 and VAMP2, are differentially expressed in the nervous system (3). VAMP1 expression is localized to neurons involved in modulating overlapping patterns, whereas VAMP2 is found in neurons ssociated with autonomic, sensory and integrative functions. In non-neuronal tissues, VAMP1 is restricted to pancreas and kidney tubular cells, whereas VAMP2 is predominantly expressed in Langerhans islets and glomerular cells (4). Evidences for VAMP
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IP, KO, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for VAMP-2 Antibody (NBP3-16362) (0)
There are no publications for VAMP-2 Antibody (NBP3-16362).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VAMP-2 Antibody (NBP3-16362) (0)
There are no reviews for VAMP-2 Antibody (NBP3-16362).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VAMP-2 Antibody (NBP3-16362) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VAMP-2 Products
Research Areas for VAMP-2 Antibody (NBP3-16362)
Find related products by research area.
|
Blogs on VAMP-2