![Western Blot: Syntaxin 3 Antibody [NBP1-86984] - Analysis in human cell line SK-MEL-30.](http://images.novusbio.com/fullsize/Syntaxin-3-Antibody-Western-Blot-NBP1-86984-img0007.jpg "Western Blot: Syntaxin 3 Antibody [NBP1-86984] - Analysis in human cell line SK-MEL-30.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGK |
| Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STX3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Epimorphin/Syntaxin 2 Antibody (338930) [Unconjugated]](https://images.novusbio.com/images2/Epimorphin_MAB2568_Immunohistochemistry_6977.jpg)
![Western Blot Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP1_AF5675_Western_Blot_5803.jpg)
![Immunohistochemistry Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP1_AF5675_Immunohistochemistry_7192.jpg)
![Knockout Validated Syntaxin-BP1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af5675_human-mouse-rat-syntaxin-bp1-affinity-purified-polyclonal-ab-knockout-validated-2410202414339.png)
![Western Blot Syntaxin-BP3/Munc18c Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP3_AF5659_Western_Blot_12110.jpg)
| Publication using NBP1-86984 | Applications | Species |
|---|---|---|
| Ikelle L, Makia M, Lewis T et al. Comparative study of PRPH2 D2 loop mutants reveals divergent disease mechanism in rods and cones Cellular and molecular life sciences : CMLS 2023-07-19 [PMID: 37466729] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for Syntaxin 3 Antibody (NBP1-86984)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STX3 |
![Immunocytochemistry/Immunofluorescence: Syntaxin 3 Antibody [NBP1-86984] - Staining of human cell line U-2 OS shows localization to nucleus, nuclear bodies & the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Syntaxin-3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86984-img0016.jpg "Immunocytochemistry/Immunofluorescence: Syntaxin 3 Antibody [NBP1-86984] - Staining of human cell line U-2 OS shows localization to nucleus, nuclear bodies & the Golgi apparatus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Syntaxin 3 Antibody [NBP1-86984] - Staining of human pancreas shows moderate to strong positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/Syntaxin-3-Antibody-Immunohistochemistry-Paraffin-NBP1-86984-img0015.jpg "Immunohistochemistry-Paraffin: Syntaxin 3 Antibody [NBP1-86984] - Staining of human pancreas shows moderate to strong positivity in islets of Langerhans.")
![Immunohistochemistry-Paraffin: Syntaxin 3 Antibody [NBP1-86984] - Staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Syntaxin-3-Antibody-Immunohistochemistry-Paraffin-NBP1-86984-img0012.jpg "Immunohistochemistry-Paraffin: Syntaxin 3 Antibody [NBP1-86984] - Staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Syntaxin 3 Antibody [NBP1-86984] - Staining of human kidney shows moderate to strong positivity in cells in tubules.](http://images.novusbio.com/fullsize/Syntaxin-3-Antibody-Immunohistochemistry-Paraffin-NBP1-86984-img0013.jpg "Immunohistochemistry-Paraffin: Syntaxin 3 Antibody [NBP1-86984] - Staining of human kidney shows moderate to strong positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Syntaxin 3 Antibody [NBP1-86984] - Staining of human duodenum shows moderate to strong positivity in apical membrane in glandular cells and lympohoid cells.](http://images.novusbio.com/fullsize/Syntaxin-3-Antibody-Immunohistochemistry-Paraffin-NBP1-86984-img0014.jpg "Immunohistochemistry-Paraffin: Syntaxin 3 Antibody [NBP1-86984] - Staining of human duodenum shows moderate to strong positivity in apical membrane in glandular cells and lympohoid cells.")
![Western Blot VAMP-8 Antibody [Unconjugated]](https://images.novusbio.com/images2/VAMP-8_AF5354_Western_Blot_5695.jpg)
![Immunohistochemistry VAMP-8 Antibody [Unconjugated]](https://images.novusbio.com/images2/VAMP8_AF5354_Immunohistochemistry_19693.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")