![Western Blot: Syntaxin 4 Antibody [NBP1-87374] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-STX4 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/Syntaxin-4-Antibody-Western-Blot-NBP1-87374-img0011.jpg "Western Blot: Syntaxin 4 Antibody [NBP1-87374] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-STX4 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STX4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100 |
||
| Theoretical MW | 34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Syntaxin-BP3/Munc18c Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP3_AF5659_Western_Blot_12110.jpg)
![Immunohistochemistry Epimorphin/Syntaxin 2 Antibody (338930) [Unconjugated]](https://images.novusbio.com/images2/Epimorphin_MAB2568_Immunohistochemistry_6977.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Syntaxin 4 Antibody (NBP1-87374)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Syntaxin 4 Antibody [NBP1-87374] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Syntaxin-4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87374-img0010.jpg "Immunocytochemistry/Immunofluorescence: Syntaxin 4 Antibody [NBP1-87374] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/Syntaxin-4-Antibody-Immunohistochemistry-Paraffin-NBP1-87374-img0015.jpg "Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.")
![Western Blot: Syntaxin 4 Antibody [NBP1-87374] - Analysis in human cell line MCF-7.](http://images.novusbio.com/fullsize/Syntaxin-4-Antibody-Western-Blot-NBP1-87374-img0007.jpg "Western Blot: Syntaxin 4 Antibody [NBP1-87374] - Analysis in human cell line MCF-7.")
![Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human lymphoid tissues shows strong membranous positivity in germinal center cells.](http://images.novusbio.com/fullsize/Syntaxin-4-Antibody-Immunohistochemistry-Paraffin-NBP1-87374-img0012.jpg "Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human lymphoid tissues shows strong membranous positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human gastrointestinal shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Syntaxin-4-Antibody-Immunohistochemistry-Paraffin-NBP1-87374-img0013.jpg "Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human gastrointestinal shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human prostate shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Syntaxin-4-Antibody-Immunohistochemistry-Paraffin-NBP1-87374-img0014.jpg "Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human prostate shows strong membranous positivity in glandular cells.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot VAMP-8 Antibody [Unconjugated]](https://images.novusbio.com/images2/VAMP-8_AF5354_Western_Blot_5695.jpg)
![Immunohistochemistry VAMP-8 Antibody [Unconjugated]](https://images.novusbio.com/images2/VAMP8_AF5354_Immunohistochemistry_19693.jpg)
![Western Blot VAMP-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VAMP-1_AF4828_Western_Blot_5561.jpg)
![Immunohistochemistry VAMP-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VAMP-1_AF4828_Immunohistochemistry_6847.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")