![Western Blot: UNC84B Antibody (8E8D7) [NBP3-15912] - Western blot analysis of extracts of various cell lines, using UNC84B antibody (NBP3-15912) at 1:2000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 60s.](http://images.novusbio.com/fullsize/UNC84B-Antibody-8E8D7-Western-Blot-NBP3-15912-img0004.jpg "Western Blot: UNC84B Antibody (8E8D7) [NBP3-15912] - Western blot analysis of extracts of various cell lines, using UNC84B antibody (NBP3-15912) at 1:2000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 60s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clone | 8E8D7 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 618-717 of human UNC84B (Q9UH99). RIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHGEPAH |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | SUN2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for UNC84B Antibody (NBP3-15912)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SUN2 |
![Immunohistochemistry-Paraffin: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry of paraffin-embedded mouse heart using UNC84B Rabbit mAb (NBP3-15912) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/UNC84B-Antibody-8E8D7-Immunohistochemistry-Paraffin-NBP3-15912-img0003.jpg "Immunohistochemistry-Paraffin: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry of paraffin-embedded mouse heart using UNC84B Rabbit mAb (NBP3-15912) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry of paraffin-embedded rat ovary using UNC84B Rabbit mAb (NBP3-15912) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/UNC84B-Antibody-8E8D7-Immunohistochemistry-Paraffin-NBP3-15912-img0001.jpg "Immunohistochemistry-Paraffin: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry of paraffin-embedded rat ovary using UNC84B Rabbit mAb (NBP3-15912) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry of paraffin-embedded human esophagus using UNC84B Rabbit mAb (NBP3-15912) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/UNC84B-Antibody-8E8D7-Immunohistochemistry-Paraffin-NBP3-15912-img0002.jpg "Immunohistochemistry-Paraffin: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry of paraffin-embedded human esophagus using UNC84B Rabbit mAb (NBP3-15912) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded human thyroid cancer tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15912_rabbit-unc84b-mab-8e8d7-7220251244337.jpg "Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded human thyroid cancer tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded mouse brain tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15912_rabbit-unc84b-mab-8e8d7-72202512432017.jpg "Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded mouse brain tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded mouse testis tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15912_rabbit-unc84b-mab-8e8d7-72202512435387.jpg "Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded mouse testis tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded rat brain tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15912_rabbit-unc84b-mab-8e8d7-72202512443359.jpg "Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded rat brain tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded Human lung adenocarcinoma tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15912_rabbit-unc84b-mab-8e8d7-72202512432067.jpg "Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded Human lung adenocarcinoma tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![N/A Neutrophil Elastase/ELA2 [Biotin]](https://images.novusbio.com/images2/DATA_Neutrophil_Elastase_DY451705_ELISA_2461.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")