![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Analysis in human skin and bone marrow tissues. Corresponding SUN1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunohistochemistry-Paraffin-NBP1-87396-img0019.jpg "Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Analysis in human skin and bone marrow tissues. Corresponding SUN1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SUN1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SUN1 Antibody (NBP1-87396)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human fallopian tube, kidney, skin and testis using Anti-SUN1 antibody NBP1-87396 (A) shows similar protein distribution across tissues to independent antibody NBP1-87395 (B).](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunohistochemistry-Paraffin-NBP1-87396-img0021.jpg "Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human fallopian tube, kidney, skin and testis using Anti-SUN1 antibody NBP1-87396 (A) shows similar protein distribution across tissues to independent antibody NBP1-87395 (B).")
![Western Blot: SUN1 Antibody [NBP1-87396] - Western blot analysis of protein expression levels in control and irradiated MCF7 and U2OS cells. Blot cuts showing signals of intact proteins. Note, reduction of SUN2 protein and near absence of H3K9me3 epigenetic modification in senescent cells (7 days post irradiation). Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/2073-4409/9/4/999), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SUN1-Antibody-Western-Blot-NBP1-87396-img0028.jpg "Western Blot: SUN1 Antibody [NBP1-87396] - Western blot analysis of protein expression levels in control and irradiated MCF7 and U2OS cells. Blot cuts showing signals of intact proteins. Note, reduction of SUN2 protein and near absence of H3K9me3 epigenetic modification in senescent cells (7 days post irradiation). Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/2073-4409/9/4/999), licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: SUN1 Antibody [NBP1-87396] - Examples of SUN1 a& nesprin-1 mislocalization in MCF7 and U2OS cells 24 h PI with 8 Gy of gamma-rays. 1a-Central slices through nucleus of MCF7 control show SUN1 & nesprin-1 in whole nucleus. 2-Convoluted nucleus of U2OS. 2a-Slice showing interrupted LA/C. 3-Convoluted nucleus of MCF7 containing 2 large MN, several blisters, and small MN bordered by LAC and filled by SUN1. 5-Tweens of MCF7 daughter nuclei connected by a thin anaphase bridge have fragmented SUN1 in the NE (arrows). 6-U2OS nucleus with amplified SUN1 and a clump (arrow) containing SUN1 and nesprin-1. Size bar indicates 5um. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/2073-4409/9/4/999), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87396-img0027.jpg "Immunocytochemistry/Immunofluorescence: SUN1 Antibody [NBP1-87396] - Examples of SUN1 a& nesprin-1 mislocalization in MCF7 and U2OS cells 24 h PI with 8 Gy of gamma-rays. 1a-Central slices through nucleus of MCF7 control show SUN1 & nesprin-1 in whole nucleus. 2-Convoluted nucleus of U2OS. 2a-Slice showing interrupted LA/C. 3-Convoluted nucleus of MCF7 containing 2 large MN, several blisters, and small MN bordered by LAC and filled by SUN1. 5-Tweens of MCF7 daughter nuclei connected by a thin anaphase bridge have fragmented SUN1 in the NE (arrows). 6-U2OS nucleus with amplified SUN1 and a clump (arrow) containing SUN1 and nesprin-1. Size bar indicates 5um. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/2073-4409/9/4/999), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human testis shows strong positivity in nuclear membrane in Leydig cells.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunohistochemistry-Paraffin-NBP1-87396-img0026.jpg "Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human testis shows strong positivity in nuclear membrane in Leydig cells.")
![Immunocytochemistry/Immunofluorescence: SUN1 Antibody [NBP1-87396] - Staining of A431 cells at 4ug/ml against Dylight 488 (Green). Alpha-tubulin and nuclei were counterstained against Dylight 550 (red) and DAPI (blue), respectively.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87396-img0005.jpg "Immunocytochemistry/Immunofluorescence: SUN1 Antibody [NBP1-87396] - Staining of A431 cells at 4ug/ml against Dylight 488 (Green). Alpha-tubulin and nuclei were counterstained against Dylight 550 (red) and DAPI (blue), respectively.")
![Immunocytochemistry/Immunofluorescence: SUN1 Antibody [NBP1-87396] - Staining of human cell line A-431 shows positivity in nuclear membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87396-img0004.jpg "Immunocytochemistry/Immunofluorescence: SUN1 Antibody [NBP1-87396] - Staining of human cell line A-431 shows positivity in nuclear membrane. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human bone marrow shows low positivity in hematopoietic cells as expected.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunohistochemistry-Paraffin-NBP1-87396-img0020.jpg "Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human bone marrow shows low positivity in hematopoietic cells as expected.")
![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human Fallopian tube shows moderate positivity in nuclear membrane in glandular cells.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunohistochemistry-Paraffin-NBP1-87396-img0022.jpg "Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human Fallopian tube shows moderate positivity in nuclear membrane in glandular cells.")
![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human kidney shows strong positivity in nuclear membrane in cells in glomeruli.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunohistochemistry-Paraffin-NBP1-87396-img0023.jpg "Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human kidney shows strong positivity in nuclear membrane in cells in glomeruli.")
![Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human skin shows strong positivity in nuclear membrane in squamous epithelial cells.](http://images.novusbio.com/fullsize/SUN1-Antibody-Immunohistochemistry-Paraffin-NBP1-87396-img0025.jpg "Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87396] - Staining of human skin shows strong positivity in nuclear membrane in squamous epithelial cells.")
![Simple Western: SUN1 Antibody [NBP1-87396] - Simple Western lane view shows a specific band for SUN1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/SUN1-Antibody-Simple-Western-NBP1-87396-img0007.jpg "Simple Western: SUN1 Antibody [NBP1-87396] - Simple Western lane view shows a specific band for SUN1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: SUN1 Antibody [NBP1-87396] - Electropherogram image(s) of corresponding Simple Western lane view. SUN1 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).](http://images.novusbio.com/fullsize/SUN1-Antibody-Simple-Western-NBP1-87396-img0009.jpg "Simple Western: SUN1 Antibody [NBP1-87396] - Electropherogram image(s) of corresponding Simple Western lane view. SUN1 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).")
![Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [NBP1-87396] - Examples of nuclear morphology defects in (A) MCF7 & (B) U2OS cell lines 24 h PI with the dose of 8 Gy of gamma -rays. (A) 1—An anaphase bridge linking the separating daughter nuclei, SUN1 (red), nesprin1 (green), 2—Convoluted nucleus with blisters (arrows), LA/C (green), emerin (red). 3—Fragmented nucleus represented by 3 large & numerous small micronuclei. SUN2 (red), nesprin-1 (green). (B) 1— A giant nucleus with small chromatin fragments & micronuclei (MN, arrows), SUN1 (red), nesprin-1 (green). 2—Nucleus with micronuclei, emerin (red), lamin A/C (green), arrows indicate MN containing emerin & heterochromatin (HC), 3—Convoluted nucleus with blisters (arrows), emerin (red), LA/C (green). 4—Fragmented nucleus, emerin (red), LA/C (green). 5—Honeycombed nucleus, emerin (red), LA/C (green), thick arrow shows interrupted NE enabling chromatin to leak out of the nucleus, reinforced layer of LA/C (green) & emerin (red), (thin arrows). Size bar indicates µm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32316379), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-87396_rabbit-polyclonal-sun1-antibody-310202416121982.jpg "Immunocytochemistry/ Immunofluorescence: SUN1 Antibody [NBP1-87396] - Examples of nuclear morphology defects in (A) MCF7 & (B) U2OS cell lines 24 h PI with the dose of 8 Gy of gamma -rays. (A) 1—An anaphase bridge linking the separating daughter nuclei, SUN1 (red), nesprin1 (green), 2—Convoluted nucleus with blisters (arrows), LA/C (green), emerin (red). 3—Fragmented nucleus represented by 3 large & numerous small micronuclei. SUN2 (red), nesprin-1 (green). (B) 1— A giant nucleus with small chromatin fragments & micronuclei (MN, arrows), SUN1 (red), nesprin-1 (green). 2—Nucleus with micronuclei, emerin (red), lamin A/C (green), arrows indicate MN containing emerin & heterochromatin (HC), 3—Convoluted nucleus with blisters (arrows), emerin (red), LA/C (green). 4—Fragmented nucleus, emerin (red), LA/C (green). 5—Honeycombed nucleus, emerin (red), LA/C (green), thick arrow shows interrupted NE enabling chromatin to leak out of the nucleus, reinforced layer of LA/C (green) & emerin (red), (thin arrows). Size bar indicates µm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32316379), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![N/A Neutrophil Elastase/ELA2 [Biotin]](https://images.novusbio.com/images2/DATA_Neutrophil_Elastase_DY451705_ELISA_2461.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")