Novus Biologicals products are now on bio-techne.com

Uev1a/UBE2V1 Recombinant Protein Antigen

Images

 
There are currently no images for Uev1a/UBE2V1 Recombinant Protein Antigen (NBP2-57183PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Uev1a/UBE2V1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Uev1a/UBE2V1.

Source: E. coli

Amino Acid Sequence: LLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UBE2V1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57183.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Uev1a/UBE2V1 Recombinant Protein Antigen

  • CIR1
  • CROC1
  • CROC1TRAF6-regulated IKK activator 1 beta Uev1A
  • CROC-1UBE2V
  • UBE2V1
  • ubiquitin-conjugating enzyme E2 variant 1
  • Uev1a
  • UEV-1CIR1
  • UEV1DNA-binding protein

Background

Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Multiple alternatively spliced transcripts encoding different isoforms have been described for this gene. A pseudogene has been identified which is also located on chromosome 20. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76593
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56360
Species: Hu
Applications: WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NB100-56363
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
E2-627
Species: Hu, Mu, Rt
Applications: EnzAct
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
U-100H
Species: Hu
Applications: EnzAct
NBP2-94633
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-130
Species: Bv, Ce, Ch, Dr, Eq, Hu, Pm, Mu, Pl, Po, Rt, Ze
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-26504
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
PP-H0107B-00
Species: Hu
Applications: DirELISA, IHC, IP, WB

Publications for Uev1a/UBE2V1 Recombinant Protein Antigen (NBP2-57183PEP) (0)

There are no publications for Uev1a/UBE2V1 Recombinant Protein Antigen (NBP2-57183PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Uev1a/UBE2V1 Recombinant Protein Antigen (NBP2-57183PEP) (0)

There are no reviews for Uev1a/UBE2V1 Recombinant Protein Antigen (NBP2-57183PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Uev1a/UBE2V1 Recombinant Protein Antigen (NBP2-57183PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Uev1a/UBE2V1 Products

Research Areas for Uev1a/UBE2V1 Recombinant Protein Antigen (NBP2-57183PEP)

Find related products by research area.

Blogs on Uev1a/UBE2V1

There are no specific blogs for Uev1a/UBE2V1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Uev1a/UBE2V1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2V1