UCH-L1/PGP9.5 Antibody (CL3210) [FITC] Summary
Immunogen |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL |
Isotype |
IgG1 |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
UCHL1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
PBS |
Preservative |
0.05% Sodium Azide |
Purity |
Protein A purified |
Alternate Names for UCH-L1/PGP9.5 Antibody (CL3210) [FITC]
Background
Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCHL1) is a soluble cytoplasmic protein found in neurons and in cells of the diffuse neuroendocrine system, and their respective tumors. Therefore, UCH-L1 has been widely used as a peripheral nerve fiber marker. UCHL-1 functions as a tissue-specific ubiquitin carboxyl terminal hydrolase isoenzyme involved in the processing of both ubiquitin precursors and ubiquitinated proteins.
UCH L1 is down-regulated in brains from Parkinson disease and Alzheimer disease patients, and certian site specific mutations in the UCHL1 gene can either increase or decrese the risk of Parkinson's and/or Alzheimer's neurodegenerative diseases.
Human UCHL 1 and the closely related UCHL3 protein have one of the most complicated knot structures ever discovered, with five knot crossings. This knot structure is expected to help the protein resist degradation in the proteasome.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, In vitro, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for UCH-L1/PGP9.5 Antibody (NBP2-46621F) (0)
There are no publications for UCH-L1/PGP9.5 Antibody (NBP2-46621F).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for UCH-L1/PGP9.5 Antibody (NBP2-46621F) (0)
There are no reviews for UCH-L1/PGP9.5 Antibody (NBP2-46621F).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for UCH-L1/PGP9.5 Antibody (NBP2-46621F) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional UCH-L1/PGP9.5 Products
Research Areas for UCH-L1/PGP9.5 Antibody (NBP2-46621F)
Find related products by research area.
|
Blogs on UCH-L1/PGP9.5