![Western Blot: UBE2Z Antibody (4B1) [H00065264-M01] - UBE2Z monoclonal antibody (M01), clone 4B1. Analysis of UBE2Z expression in K-562.](http://images.novusbio.com/fullsize/UBE2Z-Antibody-4B1-Western-Blot-H00065264-M01-img0007.jpg "Western Blot: UBE2Z Antibody (4B1) [H00065264-M01] - UBE2Z monoclonal antibody (M01), clone 4B1. Analysis of UBE2Z expression in K-562.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 4B1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | UBE2Z (NP_075567, 136 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENA |
| Specificity | This product is specific for Human UBE2Z monoclonal antibody (M01), clone 4B1 [Gene ID: 65264]. |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | UBE2Z |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Mouse monoclonal antibody raised against a partial recombinant UBE2Z. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: UBE2Z Antibody (4B1) [H00065264-M01] - Analysis of monoclonal antibody to UBE2Z on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/UBE2Z-Antibody-4B1-Immunocytochemistry-Immunofluorescence-H00065264-M01-img0005.jpg "Immunocytochemistry/Immunofluorescence: UBE2Z Antibody (4B1) [H00065264-M01] - Analysis of monoclonal antibody to UBE2Z on HeLa cell . Antibody concentration 10 ug/ml.")
![Sandwich ELISA: UBE2Z Antibody (4B1) [H00065264-M01] - Detection limit for recombinant GST tagged UBE2Z is 3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/UBE2Z-Antibody-4B1-Sandwich-ELISA-H00065264-M01-img0006.jpg "Sandwich ELISA: UBE2Z Antibody (4B1) [H00065264-M01] - Detection limit for recombinant GST tagged UBE2Z is 3 ng/ml as a capture antibody.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
