Novus Biologicals products are now on bio-techne.com

Tubby Recombinant Protein Antigen

Images

 
There are currently no images for Tubby Recombinant Protein Antigen (NBP2-48924PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Tubby Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Tubby.

Source: E. coli

Amino Acid Sequence: LPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRRDRRTTRRKYWKEGREI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TUB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48924.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tubby Recombinant Protein Antigen

  • RD5
  • RDOB
  • tubby (mouse) homolog
  • tubby homolog (mouse)
  • Tubby Homolog
  • tubby homologue
  • tubby protein homolog
  • Tubby

Background

Tub-1 protein is C. elegans tubby homolog, required for normal sensory behavior. It is expressed in ciliated neurons and undergoes both cilated and dendritic transport. It has been shown to be involved in regulating fat storage, most likely by modulating transport, sensing, or responding to signals in ciliated neurons. It has also been shown to play a role in regulating life span, but by a different mechanism than fat storage regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31401
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-533
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
DLP00
Species: Hu
Applications: ELISA
NBP2-52559
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP3-42341
Species: Hu, Po, Rt
Applications: IHC, WB
NBP1-89278
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32660
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF3587
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
NBP2-01671
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-84685
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF497
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-59677
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-47914
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-20849
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-48924PEP
Species: Hu
Applications: AC

Publications for Tubby Recombinant Protein Antigen (NBP2-48924PEP) (0)

There are no publications for Tubby Recombinant Protein Antigen (NBP2-48924PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tubby Recombinant Protein Antigen (NBP2-48924PEP) (0)

There are no reviews for Tubby Recombinant Protein Antigen (NBP2-48924PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tubby Recombinant Protein Antigen (NBP2-48924PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tubby Products

Array NBP2-48924PEP

Research Areas for Tubby Recombinant Protein Antigen (NBP2-48924PEP)

Find related products by research area.

Blogs on Tubby.

Auditory Infographic: Can you hear me now?
The auditory process involves several structures of the ear to convert sound waves into information that is processed by our brain. Learn more about the auditory process in our infographic below. Novus Biologicals offers reagents mentioned in the inf...  Read full blog post.

Can Tubby Make You Tubby?
The TUB gene, which encodes for the protein Tubby, is evolutionarily conserved in human, chimpanzee, dog, cow, mouse, chicken, zebrafish, fruit fly, mosquito, C. elegans, and rice. The gene derives its name from its role in metabolism; mice with a m...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tubby Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TUB