![Western Blot: ACOT7 Antibody [NBP1-89278] - Analysis using Anti-ACOT7 antibody NBP1-89278 (A) shows similar pattern to independent antibody NBP1-89279 (B).](http://images.novusbio.com/fullsize/ACOT7-Antibody-Western-Blot-NBP1-89278-img0012.jpg "Western Blot: ACOT7 Antibody [NBP1-89278] - Analysis using Anti-ACOT7 antibody NBP1-89278 (A) shows similar pattern to independent antibody NBP1-89279 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITGRIMRPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACOT7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 42 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ACOT7 Antibody (NBP1-89278)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ACOT7 Antibody [NBP1-89278] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize/ACOT7-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89278-img0007.jpg "Immunocytochemistry/Immunofluorescence: ACOT7 Antibody [NBP1-89278] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.")
![Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89278] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/ACOT7-Antibody-Immunohistochemistry-Paraffin-NBP1-89278-img0016.jpg "Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89278] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89278] - Staining of human cerebellum, cerebral cortex, kidney and pancreas using Anti-ACOT7 antibody NBP1-89278 (A) shows similar protein distribution across tissues to independent antibody NBP1-89279 (B).](http://images.novusbio.com/fullsize/ACOT7-Antibody-Immunohistochemistry-Paraffin-NBP1-89278-img0011.jpg "Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89278] - Staining of human cerebellum, cerebral cortex, kidney and pancreas using Anti-ACOT7 antibody NBP1-89278 (A) shows similar protein distribution across tissues to independent antibody NBP1-89279 (B).")
![Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89278] - Analysis in human cerebral cortex and pancreas tissues. Corresponding ACOT7 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ACOT7-Antibody-Immunohistochemistry-Paraffin-NBP1-89278-img0013.jpg "Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89278] - Analysis in human cerebral cortex and pancreas tissues. Corresponding ACOT7 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89278] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/ACOT7-Antibody-Immunohistochemistry-Paraffin-NBP1-89278-img0014.jpg "Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89278] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89278] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/ACOT7-Antibody-Immunohistochemistry-Paraffin-NBP1-89278-img0015.jpg "Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89278] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89278] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/ACOT7-Antibody-Immunohistochemistry-Paraffin-NBP1-89278-img0017.jpg "Immunohistochemistry-Paraffin: ACOT7 Antibody [NBP1-89278] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![Western Blot Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Western_Blot_17082.jpg)
![Simple Western Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Simple_Western_18689.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![Intracellular Staining by Flow Cytometry Serpin A5/Protein C Inhibitor Antibody (210326) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1266_human-serpin-a5-mab-clone-210326-intracellular-staining-by-flow-cytometry-662020192248.jpg)
![Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Western_Blot_17309.jpg)
![Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry__Immunofluorescence_17494.jpg)
![Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]](https://images.novusbio.com/images2/Serpin_A1_MAB1268_Immunocytochemistry_11973.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")