![Western Blot: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of extracts of various cell lines, using Tropomyosin-1 Rabbit mAb (NBP3-16689) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.](http://images.novusbio.com/fullsize/Tropomyosin-1-Antibody-5Q2H6-Western-Blot-NBP3-16689-img0005.jpg "Western Blot: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of extracts of various cell lines, using Tropomyosin-1 Rabbit mAb (NBP3-16689) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.")
| Reactivity | Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP |
| Clone | 5Q2H6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 185-284 of human Tropomyosin-1 (P09493). LSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | TPM1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Immunohistochemistry_19508.jpg)
![Western Blot MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Western_Blot_19525.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Tropomyosin-1 Antibody (NBP3-16689)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TPM1 |
![Immunohistochemistry: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of mouse heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Tropomyosin-1-Antibody-5Q2H6-Immunohistochemistry-NBP3-16689-img0004.jpg "Immunohistochemistry: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of mouse heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Rat heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Tropomyosin-1-Antibody-5Q2H6-Immunohistochemistry-Paraffin-NBP3-16689-img0001.jpg "Immunohistochemistry-Paraffin: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Rat heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Mouse heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Tropomyosin-1-Antibody-5Q2H6-Immunohistochemistry-Paraffin-NBP3-16689-img0002.jpg "Immunohistochemistry-Paraffin: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Mouse heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of rat heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Tropomyosin-1-Antibody-5Q2H6-Immunohistochemistry-NBP3-16689-img0003.jpg "Immunohistochemistry: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of rat heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunoprecipitation: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of 600ug extracts of Rat heart cells using 3ug Tropomyosin-1 antibody (NBP3-16689). Western blot was performed from the immunoprecipitate using Tropomyosin-1 antibody (NBP3-16689) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/Tropomyosin-1-Antibody-5Q2H6-Immunoprecipitation-NBP3-16689-img0006.jpg "Immunoprecipitation: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of 600ug extracts of Rat heart cells using 3ug Tropomyosin-1 antibody (NBP3-16689). Western blot was performed from the immunoprecipitate using Tropomyosin-1 antibody (NBP3-16689) at a dilition of 1:1000.")
![Immunocytochemistry Cardiac Troponin T Antibody (200805) [Unconjugated] - (Cardiac)](https://images.novusbio.com/images2/Troponin_T_MAB1874_Immunocytochemistry_15884.jpg)
![Immunohistochemistry Cardiac Troponin T Antibody (200805) [Unconjugated] - (Cardiac)](https://images.novusbio.com/images2/Troponin_T_MAB1874_Immunohistochemistry_17796.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Immunocytochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombomodulin_AF3894_Immunocytochemistry__Immunofluorescence_17780.jpg)
![Immunohistochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombomodulin_AF3894_Immunohistochemistry_24179.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")