Home » TRAM1 » TRAM1 Proteins » TRAM1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TRAM1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TRAM1 Protein (NBP1-80669PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TRAM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAM1.

Source: E. coli

Amino Acid Sequence: RRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRAM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80669.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRAM1 Recombinant Protein Antigen

  • PNAS8
  • PRO1292
  • TRAMP
  • TRAMtranslocating chain-associated membrane protein 1
  • translocating chain-associating membrane protein
  • translocation associated membrane protein 1
  • translocation-associating membrane protein 1

Background

This gene encodes a multi-pass membrane protein that is part of the mammalian endoplasmic reticulum. The encoded protein influences glycosylation and facilitates the translocation of secretory proteins across the endoplasmic reticulum membrane by regulating which domains of the nascent polypeptide chain are visible to the cytosol during a translocational pause.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(141 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
TRIF/TICAM1
Antibody - BSA Free
NB120-13810
Western Blot TRIF/TICAM1 Antibody - BSA Free
Unknown TRIF/TICAM1 Antibody - BSA Free
Immunohistochemistry-Paraffin TRIF/TICAM1 Antibody - BSA Free
(37 Publications)
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
TIRAP (TLR2 and
TLR4) Inhibitor Pepti ...
NBP2-26245
Other TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Other TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Other TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
(8 Publications)
Species: Hu, Mu
Applications: Flow, In vitro
MyD88 Inhibitor
Peptide Set
NBP2-29328
MyD88 Inhibitor Peptide Set
(3 Reviews)
(99 Publications)
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
RNF36 Antibody
NB100-1207
Immunohistochemistry-Paraffin RNF36 Antibody
Immunohistochemistry-Paraffin RNF36 Antibody
Western Blot RNF36 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
DR3/TNFRSF25
[Unconjugated]
943-D3
DR3/TNFRSF25 [Unconjugated]
(7 Publications)
Species: Hu
Applications: Bind
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NCOA3/AIB1 Antibody
NB100-314
Western Blot NCOA3/AIB1 Antibody
Western Blot NCOA3/AIB1 Antibody
(1 Review)
(4 Publications)
Species: Hu
Applications: IP, WB
TRAM/TICAM2
Antibody
NBP2-24686
Immunohistochemistry-Paraffin TRAM/TICAM2 Antibody
Western Blot TRAM/TICAM2 Antibody
Species: Bv, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
MAL Antibody
(B5-G3)
NBP2-75563
Flow Cytometry MAL Antibody (B5-G3)
Immunohistochemistry-Paraffin MAL Antibody (B5-G3)
Immunohistochemistry-Paraffin MAL Antibody (B5-G3)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Mkl1 Antibody
NBP1-88498
Immunohistochemistry-Paraffin Mkl1 Antibody
Immunohistochemistry-Paraffin Mkl1 Antibody
Immunohistochemistry-Paraffin Mkl1 Antibody
(8 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(685 Publications)
Species: Hu
Applications: ELISA
TLR3 Antibody
(40C1285.6) - BSA Fre
NBP2-24875
Flow Cytometry TLR3 Antibody (40C1285.6) - BSA Free
Western Blot TLR3 Antibody (40C1285.6) - BSA Free
Flow Cytometry TLR3 Antibody (40C1285.6) - BSA Free
(87 Publications)
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
TLR2 Antibody
(TL2.1) - BSA Free
NB100-56722
Flow (Cell Surface) TLR2 Antibody (TL2.1) - BSA Free
Flow Cytometry TLR2 Antibody (TL2.1) - BSA Free
Block/ Neutralize TLR2 Antibody (TL2.1) - BSA Free
(64 Publications)
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(50 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
FLAP Antibody
NB300-891
Immunohistochemistry-Paraffin FLAP Antibody
Immunohistochemistry-Paraffin FLAP Antibody
Immunocytochemistry/ Immunofluorescence FLAP Antibody
(12 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
TRAM1 Recombinant
Protein Antigen
NBP1-80669PEP
TRAM1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for TRAM1 Protein (NBP1-80669PEP) (0)

There are no publications for TRAM1 Protein (NBP1-80669PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAM1 Protein (NBP1-80669PEP) (0)

There are no reviews for TRAM1 Protein (NBP1-80669PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRAM1 Protein (NBP1-80669PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRAM1 Products

Research Areas for TRAM1 Protein (NBP1-80669PEP)

Find related products by research area.

Blogs on TRAM1

There are no specific blogs for TRAM1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - FFPE tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, ACD catalog # 311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog # NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
TLR4 Antibody (76B357.1) - BSA Free
NB100-56566

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRAM1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TRAM1