Home » TNIP1 » TNIP1 Antibodies » TNIP1 Antibody
Novus Biologicals products are now on bio-techne.com

TNIP1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: TNIP1 Antibody [NBP2-32705] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Genetic Strategies: Western Blot: TNIP1 Antibody [NBP2-32705] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. ...read more
Immunohistochemistry: TNIP1 Antibody [NBP2-32705] - Staining of human tonsil shows strong cytoplasmic positivity in subset of non-germinal center cells.
Independent Antibodies: Western Blot: TNIP1 Antibody [NBP2-32705] - Analysis using Anti-TNIP1 antibody NBP2-32705 (A) shows similar pattern to independent antibody NBP1-89306 (B).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

    

Genetic Strategies

    

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TNIP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLNKALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVT
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TNIP1 Protein (NBP2-32705PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TNIP1 Antibody

  • ABIN-1
  • HIV-1 Nef-interacting protein
  • hVAN
  • KIAA0113nip40-1
  • Naf1
  • NAF1TNFAIP3-interacting protein 1
  • Nef-associated factor 1 SNP
  • Nef-associated factor 1
  • Nip40-1
  • TNFAIP3 interacting protein 1
  • VANvirion-associated nuclear-shuttling protein
  • Virion-associated nuclear shuttling protein

Background

Interacts with zinc finger protein A20/TNFAIP3 and inhibits TNF-induced NF-kappa-B-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal . Increases cell surface CD4(T4) antigen expression. Interacts with HIV-1 matrix protein and is packaged into virions and overexpression can inhibit viral replication. May regulate matrix nuclear localization, both nuclear import of PIC (Preintegration complex) and export of GAG polyprotein and viral genomic RNA during virion production

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

IRF6 Antibody
NBP1-51911
Western Blot IRF6 Antibody
Western Blot IRF6 Antibody
Immunohistochemistry-Paraffin IRF6 Antibody
(8 Publications)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, PEP-ELISA, WB
A20/TNFAIP3
Antibody (59A426) - B ...
NBP1-77533
Flow Cytometry A20/TNFAIP3 Antibody (59A426) - BSA Free
Immunocytochemistry/ Immunofluorescence A20/TNFAIP3 Antibody (59A426) - BSA Free
Flow Cytometry A20/TNFAIP3 Antibody (59A426) - BSA Free
(42 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(813 Publications)
Species: Hu
Applications: BA
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Actin Antibody
(mAbGEa)
NB100-74340
Immunocytochemistry/ Immunofluorescence Actin Antibody (mAbGEa)
Western Blot Actin Antibody (mAbGEa)
Immunocytochemistry/ Immunofluorescence Actin Antibody (mAbGEa)
(8 Reviews)
(33 Publications)
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
SOST/Sclerostin
Antibody [Unconjugate
AF1589
Immunohistochemistry SOST/Sclerostin Antibody [Unconjugated]
Immunohistochemistry SOST/Sclerostin Antibody [Unconjugated]
Western Blot SOST/Sclerostin Antibody [Unconjugated]
(2 Reviews)
(104 Publications)
Species: Mu
Applications: IHC, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(840 Publications)
Species: Hu
Applications: BA
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
TNIP3 Antibody -
BSA Free
NBP1-77365
Immunohistochemistry TNIP3 Antibody - BSA Free
Immunohistochemistry TNIP3 Antibody - BSA Free
Immunohistochemistry-Paraffin TNIP3 Antibody - BSA Free
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
TNIP2 Antibody
NBP1-32689
Western Blot TNIP2 Antibody
Immunocytochemistry/ Immunofluorescence TNIP2 Antibody
Immunohistochemistry-Paraffin TNIP2 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
IL-23A/IL-23 P19
[Unconjugated]
1290-IL
IL-23A/IL-23 P19 [Unconjugated]
(115 Publications)
Species: Hu
Applications: BA
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
RNPC3 Antibody -
BSA Free
NBP2-93867
Western Blot RNPC3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: WB
IKK gamma
Inhibitor Peptide Set
NBP2-26504
In vivo assay IKK gamma Inhibitor Peptide Set
In vivo assay IKK gamma Inhibitor Peptide Set
Unknown IKK gamma Inhibitor Peptide Set
(22 Publications)
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
Vang-like Protein
2/VANGL2 Antibody
AF4815
Western Blot Vang-like Protein 2/VANGL2 Antibody
Immunohistochemistry Vang-like Protein 2/VANGL2 Antibody
(12 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
TNIP1 Antibody
NBP2-32705
TNIP1 Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, KD

Publications for TNIP1 Antibody (NBP2-32705) (0)

There are no publications for TNIP1 Antibody (NBP2-32705).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNIP1 Antibody (NBP2-32705) (0)

There are no reviews for TNIP1 Antibody (NBP2-32705). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNIP1 Antibody (NBP2-32705) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TNIP1 Products

Research Areas for TNIP1 Antibody (NBP2-32705)

Find related products by research area.

Blogs on TNIP1

There are no specific blogs for TNIP1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNIP1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TNIP1