Novus Biologicals products are now on bio-techne.com

TMEM131 Recombinant Protein Antigen

Name: TMEM131 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-86591PEP
Price: 279 USD

Images

There are currently no images for TMEM131 Protein (NBP1-86591PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TMEM131 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMEM131. Source: E. coli Amino Acid Sequence: PKIEERFIDFGVLSATEASNILFAIINSNPIELAIKSWHIIGDGLSIELVAVERGNRTTIISSLPEFEKSSLSDQSSVTLASGYFAVFRVKLTAKKLEGIHDGAIQITTDYE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	TMEM131
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86591. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TMEM131 Recombinant Protein Antigen

KIAA02572610524E03Rik
PRO1048
Protein RW1
RW1CC28
transmembrane protein 131
YR-23

Background

Transmembrane protein 131 (TMEM131) is a multi-pass membrane protein of unknown function. It has been found to be up-regulated in T-lineage pre-cursors and multipotent progenitor cells. TMEM131 is also known as RW1 and Neg. It is predicted to have two transmembrane domains, and its gene is located on human chromosome 2 directly adjacent to ZAP70.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Complement Factor
D/Adipsin Antibody [U ...

AF5430

(13 Publications)

Species: Mu

Applications: IP, WB

FDX1 Antibody

NBP1-89227

Immunohistochemistry-Paraffin FDX1 Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

AKR1C2 Antibody

NBP3-35145

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

TCF7/TCF1 Antibody
(812145) [Unconjugate ...

MAB8224

Intracellular Staining by Flow Cytometry TCF7/TCF1 Antibody (812145) [Unconjugated]

(3 Publications)

Species: Mu

Applications: CyTOF-ready, ICFlow, WB

SERCA2 ATPase
Antibody (2A7-A1)

NB300-581

(2 Reviews)

(16 Publications)

Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh

Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

RFC2 Antibody
(OTI2B2)

NBP2-45570

Immunohistochemistry RFC2 Antibody (OTI2B2)

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, WB

RFC1 Antibody
[Unconjugated]

AF6457

Species: Hu

Applications: WB

NOD2 Antibody
(2D9) - BSA Free

NB100-524

Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free

(1 Review)

(26 Publications)

Species: Hu, Mu

Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

ATP6V0A1 Antibody

NBP1-89342

Immunohistochemistry-Paraffin ATP6V0A1 Antibody

(1 Review)

(13 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, IP, WB

CRAT Antibody

NBP1-86616

Immunohistochemistry-Paraffin CRAT Antibody

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

RFC4 Antibody
(OTI1A8)

NBP2-45946

Immunohistochemistry RFC4 Antibody (OTI1A8)

Species: Ca, Hu, Pm, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Glutaminyl-peptide
Cyclotransferase/QPCT ...

NBP1-81838

Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody

Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody

(1 Publication)

Species: Hu, Mu

Applications: IHC, IHC-P, WB

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

MTRF1 Antibody

H00009617-B01P

(1 Publication)

Species: Hu

Applications: WB

alpha-Sarcoglycan
Antibody (JA51-81)

NBP2-67150

Immunohistochemistry-Frozen alpha-Sarcoglycan Antibody (JA51-81)

(1 Review)

Species: Hu, Mu, Rt

Applications: IHC, IHC-Fr, IHC-P, IP, WB

Plexin A1 Antibody
[Unconjugated]

AF4309

Immunocytochemistry Plexin A1 Antibody [Unconjugated]

Western Blot Plexin A1 Antibody [Unconjugated]

(12 Publications)

Species: Hu, Mu

Applications: ICC, IHC, WB

RPL10 Antibody

NBP1-84037

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

eRF1 Antibody

NBP1-31113

Immunocytochemistry/ Immunofluorescence eRF1 Antibody

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

CD3 zeta Antibody
(BL-336-1B2)

NBP2-76399

Flow Cytometry CD3 zeta Antibody (BL-336-1B2)

Immunoprecipitation CD3 zeta Antibody (BL-336-1B2)

Species: Hu

Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB

TMEM131
Recombinant Protein A

NBP1-86591PEP

Species: Hu

Applications: AC

Publications for TMEM131 Protein (NBP1-86591PEP) (0)

There are no publications for TMEM131 Protein (NBP1-86591PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM131 Protein (NBP1-86591PEP) (0)

There are no reviews for TMEM131 Protein (NBP1-86591PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TMEM131 Protein (NBP1-86591PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMEM131 Products

Blogs on TMEM131

There are no specific blogs for TMEM131, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.

NOD2 Antibody (2D9) - BSA Free
NB100-524

Immunocytochemistry/Immunofluorescence: SERCA2 ATPase Antibody (2A7-A1) [NB300-581] - HeLa cells. Primary antibody at 1:100, secondary antibody: goat-anti mouse IgG AlexaFluor 568 at 1:100. ICC/IF image submitted by a verified customer review.

SERCA2 ATPase Antibody (2A7-A1)
NB300-581-10uL

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our TMEM131 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

TMEM131

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

TMEM131 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

TMEM131 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for TMEM131 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for TMEM131 Protein (NBP1-86591PEP) (0)

Reviews for TMEM131 Protein (NBP1-86591PEP) (0)

FAQs for TMEM131 Protein (NBP1-86591PEP) (0)

Additional TMEM131 Products

Blogs on TMEM131

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics