![Western Blot: Tetraspanin-4 Antibody [NBP1-59438] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/Tetraspanin-4-Antibody-Western-Blot-NBP1-59438-img0007.jpg "Western Blot: Tetraspanin-4 Antibody [NBP1-59438] - Jurkat cell lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to TSPAN4 (tetraspanin 4) The peptide sequence was selected from the middle region of TSPAN4) Peptide sequence YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW (NP_001020405). The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TSPAN4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Publication using NBP1-59438 | Applications | Species |
|---|---|---|
| Wu L, Yang S, Li H et al. TSPAN4-positive migrasome derived from retinal pigmented epithelium cells contributes to the development of proliferative vitreoretinopathy Journal of nanobiotechnology 2022-12-09 [PMID: 36494806] (WB, IHC, ICC/IF, Human, Rat) | WB, IHC, ICC/IF | Human, Rat |
Secondary Antibodies |
Isotype Controls |
|
Migrasomes: A Novel Vesicle Involved in Intercellular Signaling By Christina Towers, PhD What are migrasomes?A novel vesicular organelle was recently discovered in 2015 by a research group at Tsinghua University headed by Dr. Yu that is dependent on cell migration... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: Tetraspanin-4 Antibody [NBP1-59438] - Human Adult Liver Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.](http://images.novusbio.com/fullsize/Tetraspanin-4-Antibody-Immunohistochemistry-NBP1-59438-img0008.jpg "Immunohistochemistry: Tetraspanin-4 Antibody [NBP1-59438] - Human Adult Liver Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.")
![Western Blot: Tetraspanin-4 Antibody [NBP1-59438] - GST-Teraspanin EC2 Expressed in E. coli.](http://images.novusbio.com/fullsize/Tetraspanin-4-Antibody-Western-Blot-NBP1-59438-img0006.jpg "Western Blot: Tetraspanin-4 Antibody [NBP1-59438] - GST-Teraspanin EC2 Expressed in E. coli.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Flow Cytometry CD151 Antibody (455807) [Unconjugated]](https://images.novusbio.com/images2/CD151_MAB4609_Flow_Cytometry_8473.jpg)
![Immunocytochemistry CD151 Antibody (455807) [Unconjugated]](https://images.novusbio.com/images2/CD151_MAB4609_Immunocytochemistry__Immunofluorescence_19523.jpg)
![Flow Cytometry TM4SF4 Antibody (832441) [Unconjugated]](https://images.novusbio.com/images2/TM4SF4_MAB7998_Flow_Cytometry_13144.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")