![Western Blot: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Analysis of extracts of various cell lines, using CD82/Kai-1 Rabbit mAb (NBP3-16797) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/CD82-Kai-1-Antibody-0T3L6-Western-Blot-NBP3-16797-img0004.jpg "Western Blot: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Analysis of extracts of various cell lines, using CD82/Kai-1 Rabbit mAb (NBP3-16797) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 0T3L6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 168-267 of human CD82/Kai-1 (P27701). PEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CD82 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CD82/Kai-1 Antibody (NBP3-16797)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CD82 |
![Immunohistochemistry-Paraffin: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] -Human tonsil tissue using CD82 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16797_rabbit-cd82-kai-1-mab-0t3l6-immunohistochemistry-paraffin-1212202472817..png "Immunohistochemistry-Paraffin: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] -Human tonsil tissue using CD82 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.")
![Immunocytochemistry/Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of RAW 264.7 cells using CD82 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) ( dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-16797_rabbit-cd82-kai-1-mab-0t3l6-immunocytochemistry-immunofluorescence-1212202472931.png "Immunocytochemistry/Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of RAW 264.7 cells using CD82 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) ( dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Immunocytochemistry/Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of Raji cells using CD82 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-16797_rabbit-cd82-kai-1-mab-0t3l6-immunocytochemistry-immunofluorescence-1212202473046..png "Immunocytochemistry/Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of Raji cells using CD82 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Immunocytochemistry/Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of paraffin-embedded Human breast cancer using CD82 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-16797_rabbit-cd82-kai-1-mab-0t3l6-immunocytochemistry-immunofluorescence-1212202475221..png "Immunocytochemistry/Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of paraffin-embedded Human breast cancer using CD82 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.")
![Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of paraffin-embedded Human breast cancer using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-16797_rabbit-cd82-kai-1-mab-0t3l6-52202511365113.jpg "Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of paraffin-embedded Human breast cancer using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.")
![Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of Raji cells using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-16797_rabbit-cd82-kai-1-mab-0t3l6-5220251242548.jpg "Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of Raji cells using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of RAW 264.7 cells using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-16797_rabbit-cd82-kai-1-mab-0t3l6-52202511361250.jpg "Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [NBP3-16797] - Confocal imaging of RAW 264.7 cells using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [CD82/Kai-1] - Confocal imaging of paraffin-embedded Human breast cancer using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-16797_rabbit-cd82-kai-1-mab-0t3l6-5220251736374.jpg "Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [CD82/Kai-1] - Confocal imaging of paraffin-embedded Human breast cancer using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.")
![Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [CD82/Kai-1] - Confocal imaging of Raji cells using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-16797_rabbit-cd82-kai-1-mab-0t3l6-52202517311026.jpg "Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [CD82/Kai-1] - Confocal imaging of Raji cells using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [CD82/Kai-1] - Confocal imaging of RAW 264.7 cells using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-16797_rabbit-cd82-kai-1-mab-0t3l6-52202517352756.jpg "Immunocytochemistry/ Immunofluorescence: CD82/Kai-1 Antibody (0T3L6) [CD82/Kai-1] - Confocal imaging of RAW 264.7 cells using CD82/Kai-1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Flow Cytometry CD1b Antibody (737249) [Unconjugated]](https://images.novusbio.com/images2/CD1b_MAB7446_Flow_Cytometry_12185.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunocytochemistry/ Immunofluorescence PNR/NR2E3 Antibody (H7223) [Unconjugated]](https://images.novusbio.com/images/pp-h7223-00_human-pnr-nr2e3-mab-clone-h7223-41202412514869.jpg)
![Immunocytochemistry/ Immunofluorescence PNR/NR2E3 Antibody (H7223) [Unconjugated]](https://images.novusbio.com/images/pp-h7223-00_human-pnr-nr2e3-mab-clone-h7223-41202412505322.jpg)
![Complement Component C2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Complement Component C2 Antibody [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")